SecReT6
Protein ID: 170023724
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1483
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1641141..1642490 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB1JG40
KEGG IDypy:YPK_1483
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-144, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|170023724|ref|YP_001720229.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQG
PKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFI
RTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1641141-1642490 Yersinia pseudotuberculosis YPIII chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGC
GCTATCTTGAATATTACGCCCATAAGCGAGCGGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATA
TGAAATTGATAGAGAAGCGCTCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGAC
GGTACACCATTTGATATTCCCGGCCATGCTGAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGG
GTAAGTTGATCTATCTGGCGGTCCCACTGCGCCTGGATAACAGTGATGAAACCATTTTTGATGAGCACGA
TATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATACCAATGCCATTCGGCAAGGG
CCGAAGCCGGTACAACTGTCAAGATTACGCCTCAGATTAGTCTCAGAAGGTGAGATGACAGAATCATGGA
TTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGTAGTGTCTTGCTACACACCGAAGATTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGTTAACCCATCTTAATGGTTTG
GTTAAAATGCGCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAG
AAATTGTCGATTATTTGCTACTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCACAT
TCCTGAATTACCACCTATTACGCTTTATCAGGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATC
CGGACCAAAACCCGCCGACCCCGTCCGGCACCTGGCTATGATCATGCGAAGCTCTATGCGTCTATTCGTC
CGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCTGGGCAGATGATACCGCTGGA
GACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTCAAATCTGGTC
CTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCAGTACC
GCCCAGACAAATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGAC
AAGGTTTCCAATGCTGGTGCCATTGCCCTGCACGTGGCGGGTGATTTCCCGGCCTTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA