SecReT6
Protein ID: 170023725
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1484
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1642487..1643863 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDB1JG41
KEGG IDypy:YPK_1484
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-54, Aligned region: 86..291
OmpA [PF00691], Evalue: 3.40E-16, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|170023725|ref|YP_001720230.1| type VI secretion system OmpA/MotB family protein [Yersinia pseudotuberculosis YPIII]
MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPMTYPDSTQDNAAFTREAPHSGAAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILG
LGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLI
VATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGD
SMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAG
IPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1642487-1643863 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAGTGACAGCAGTGATTTGAACCTTGGGGGCTCAATGCCTCCTTTTGATCAAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAACCAATGACATACCCAGATAGCACTCAGGATAA
TGCGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGG
CTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGT
TGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCTCCGGCACTTTCTCCGCATGGGTTGATCGCACA
TCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATT
GTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGGAG
CATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGA
TGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGAC
TCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGTAATTAAACGCGTCGCGCAGG
AAGTGCATCGCGTTAAAGGGGCAATCCTCATTGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGG
CTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCACGCTATATGGAACAGGCCGGT
ATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGA
CAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA