SecReT6
Protein ID: 170023727
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1486
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1648026..1650794 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1JG43
KEGG IDypy:YPK_1486
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 4.10E-24, Aligned region: 376..469
Protein Sequence: 922 a.a.     [Download]
>gi|170023727|ref|YP_001720232.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis YPIII]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLP
IVVPPVTSPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTA
PPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPEP
TRTPPGTQTPPP
 
Nucleotide Sequence: 2769 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1648026-1650794 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCTTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAATCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCAGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGTAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAACGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACTGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCGGTCCTGAATGTTGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCAGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGATTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGTGGTGCTGCGACACTGGCGGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCTTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCGACATTGCCACCGGATCCGACATTGCCACCAGATC
CAACGTTACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCGGAAACAACGGCACCGCCAGA
AACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCA
GAGACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGC
CGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACCACGGCACCGCCGGAAACAACGGCACC
GCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCA
CCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGG
CACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAAC
GGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAACCG
ACGCGAACACCGCCAGGGACGCAGACGCCACCGCCTTGA