SecReT6
Protein ID: 170023728
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1487
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1650893..1651153 [+]
Producthypothetical protein
NotePAAR
UniProt IDB1JG44
KEGG IDypy:YPK_1487
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 6..78
PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 73..86
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 16..36
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 38..70
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 75..85
Protein Sequence: 86 a.a.     [Download]
>gi|170023728|ref|YP_001720233.1| hypothetical protein YPK_1487 [Yersinia pseudotuberculosis YPIII]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTG
CGSVIVTGSPNVFIGN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1650893-1651153 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATG
TGTTCATTAACAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGC
GCTGGTAACTGGCTCTGGAACGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGG
TGTGGCTCGGTTATTGTCACTGGGTCGCCCAATGTATTTATAGGTAACTAA