SecReT6
Protein ID: 170023730
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1489
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1652021..1652827 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB1JGE2
KEGG IDypy:YPK_1489
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.20E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|170023730|ref|YP_001720235.1| virulence protein SciE type [Yersinia pseudotuberculosis YPIII]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
AATGCFAWIADSDGRMGPVCEFISAGGYRWVPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCI
 
Nucleotide Sequence: 807 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1652021-1652827 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAACCAACGGATACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTACTGGCAGGCAAACGCAGCCCTG
GTACGTTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGC
GCTGCGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGTATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGGTCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAGATAGATTGTATTTGA