SecReT6
Protein ID: 170023731
SecReT6 ID258
T6SS typei3
Gene symbol-
Locus tagYPK_1490
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1652892..1653371 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1JGE3
KEGG IDypy:YPK_1490
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-16, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|170023731|ref|YP_001720236.1| type VI secretion system lysozyme-like protein [Yersinia pseudotuberculosis YPIII]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSV
LNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPID
LCIEGAYDVETDNAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1652892-1653371 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATA
TTGAGCCTCACGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGA
GATATTAAATAATGCCAATATTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTC
TTAAACTATGGTATTTCACCCTTGGTTGGGCTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAA
TTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAATGGCGGAATCTCTCGTTGTCAGCCAGCAACT
CCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAATGGAACCCGCACCCTATCGAT
CTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA