SecReT6
Protein ID: 170024808
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2583
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2838599..2839966 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1JQK9
KEGG IDypy:YPK_2583
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.30E-50, Aligned region: 96..150
DUF3702 [PF12486], Evalue: 1.30E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|170024808|ref|YP_001721313.1| ImpA domain-containing protein [Yersinia pseudotuberculosis YPIII]
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWARVEQLCLALFRQNGVELQTAVDFTLART
HTAGLAGLCEGLELLAGLVCHQWSGLWPPQTHVRVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCAQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASATQLDQLAQLPPLWAQARGDALLSQAQQLWPASQEVKRLSTLWQQQRE
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2839966-2838599 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAACCGGTGGCGACCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGACTGGGCGCGGGTTGAGCAACT
GTGTCTGGCGCTATTTCGCCAGAACGGCGTTGAGTTACAGACCGCCGTTGATTTTACCCTGGCACGAACG
CACACCGCCGGGTTGGCGGGTTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGA
GTGGGTTATGGCCACCGCAAACGCATGTCCGGGTGGCGTTACTGGCCTGGCTGAGTGACCGGCTGCAACA
AGTGTGGCGCACCATGACGTTATGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGCGCACAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTGCTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
CGCAGTTAGATCAACTGGCACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCCGCGAGTCAAGAGGTCAAACGGTTGAGCACTTTGTGGCAGCAACAGCGAGAA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAACTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA