SecReT6
Protein ID: 170024809
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2584
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2839991..2840443 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1JQL0
KEGG IDypy:YPK_2584
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|170024809|ref|YP_001721314.1| type VI secretion system lysozyme-like protein [Yersinia pseudotuberculosis YPIII]
MPDSSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2840443-2839991 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCCGGATTCCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAGCGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCTACCTTGCTGAAGTACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGGTATGGCACGGCGTTTATGCCTGAGGGTAGGGTGCTGATGCGCCATCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA