SecReT6
Protein ID: 170024810
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2585
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2840443..2841024 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB1JQL1
KEGG IDypy:YPK_2585
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-39, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|170024810|ref|YP_001721315.1| hypothetical protein YPK_2585 [Yersinia pseudotuberculosis YPIII]
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTARE
ALNTDEHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRAEKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2841024-2840443 Yersinia pseudotuberculosis YPIII chromosome, complete genome
GTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCAC
CGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAA
GCCCTGAATACCGATGAGCACGAAGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTAC
GTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGA
TGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGCCATCCGGATATGGCCAAAGACCACTGGCGTC
TGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGCAATAACAGCCTGAC
ATTGCGGGCGGAGAAAAAATAA