SecReT6
Protein ID: 170024811
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2586
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2840999..2842084 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1JQL2
KEGG IDypy:YPK_2586
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-81, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|170024811|ref|YP_001721316.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MGRESSVPPSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNSPADDPVRFRPHPGMGFPVSELKAL
ENDPLHPEAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGTDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTEADVT
PHCLRTVRLTSPMAFADEGANWLDGYTVLGDEAIDANSQLLISLRTADRDEAANWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPIRLGLTGVLGLDDATRSDDIPEYFTVALGHYRGLAPQQHQE
GNRRVNYRLEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2842084-2840999 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGGAAGAGAATCATCAGTCCCGCCTTCCCGGCTAATCACCCGGCTTAAGCGCGATATCGGCCAGATCA
ATTTTTACCGTTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTCGGCAGTACCAACAGCCC
GGCGGATGATCCGGTGCGTTTTCGTCCGCATCCCGGCATGGGTTTTCCGGTCAGTGAACTGAAGGCGCTG
GAAAACGACCCGCTGCATCCGGAAGCCCCGTTGACCGCGCGCACCACCTTTATGGGGTTGTACGGGGTGG
ATTCGCCTTTGCCGACGGCCTATATCGACGATATCACCCAGCAGCGCGAAGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATTTTCAACCACCGTTTTATGACGCAGTTTTATCGCATCTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCACAGACAATACCTCTCAGAGCCTGTTGGGGCTGATAGGCATGGGTATTC
CTGGCTCACAGCAGCATTTTGCCACCCCGACATCGCGCTTTCTGGCCTTGCTGGGGGTGATGCGACAACC
GGGGCGCACTGCCGAAGGGGTACAGGCGCTGGTCCGGCTGCTGGCCCCGTTTACCGAGGCGGATGTCACG
CCCCATTGCCTGCGCACGGTACGCCTGACTTCTCCGATGGCGTTTGCCGATGAAGGGGCCAACTGGCTGG
ACGGCTACACCGTGCTGGGTGATGAGGCCATTGATGCCAACAGTCAGTTGCTGATTTCGCTGCGCACGGC
AGACCGCGACGAGGCCGCTAACTGGTTACCGGATGGCCCGCTGTATACCGATTTTCTGGTGCTGTTGCGG
GTCTATCTGGGCTGGCGTTACCGGGCCTGTATCCAACTGACGGTCGCCACCCGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACACCGATAAGGCTGGGATTAACCGGCGTGCTGGGGCTGGATGACGCGACGCGGTCAGA
CGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGCTCCACAGCAACATCAAGAA
GGAAACCGACGTGTTAACTACCGTTTGGAAAAATAA