SecReT6
Protein ID: 170024812
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2587
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2842048..2843811 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JQL3
KEGG IDypy:YPK_2587
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.40E-184, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|170024812|ref|YP_001721317.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRMREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQEMKERMGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLT
LRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2843811-2842048 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGCGAAGCGGGCGAAGAGTTTG
CCCGCGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTGGA
ACGCCTGTTTGAAGGCTTTGCCTTCCTGATGGGCCGCATGCGAGAAAAACTGGATGATGACCTGCCGGAG
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGTACCATTCCGTCGCTTTCTATTGTGG
AGTTCACTCCACAATGGCAGGAGATGAAAGAGCGCATGGGGGTGAGTAAAGGTTTTGAAGTGCTATCCCG
CCCCATTGGTGAACGTGAAACCCGTTGCCGCTATACCACCACGCAAGAGATGGACCTGCTCCCTCTGACC
CTGCGCCGTGCCGGGCTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGGTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACGCTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCACTGTCGCTCTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCCCGTCATACCGGGCATCAG
GTCTATGTCCCGTTCACCAGCTTTCGCCACAAGGGGGGGATGTTGCGCCATGATGCGCCGGAGTATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTACACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTACCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACCAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTACGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGCTGAGCCA
TCTGGGCAGCAGTTTTCTGTGGATGATGGATAACGCCGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCGATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAGCGGGGCTATTTGCTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCACCTG
TTTAATCGTCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA