SecReT6
Protein ID: 170024815
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2590
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2845578..2847179 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDB1JQL6
KEGG IDypy:YPK_2590
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 354..364
Protein Sequence: 533 a.a.     [Download]
>gi|170024815|ref|YP_001721320.1| type VI secretion-associated protein [Yersinia pseudotuberculosis YPIII]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRATSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQGLSLWDEGVRPQLGGLYTALENRLVQSGGLNAVVPQNSSGS
SSAGSLNPANMASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWEPGLVFEVKAR
RLKLLRMKAQRGDSDKTRLHAEMESLLGGLIALDPARAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2847179-2845578 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCCGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTGCAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGCTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGGGGCTCAGTCTCTGGGACGAAGGCGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGTGCAATCTGGCGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCGGCCAACATGGCGTCACCGGCGTTGCGCCCAGTGCAATCGGGGCGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACATCAGTCACCGCCATTAGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAGCTCAAGCGGCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
CCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGCAGTCACGACCGGGGATCACCACGGCGCGCCATCAGTGGCTGCTGC
GTCTGGTGATGGCCCGGGTGGCGGAGCAGTACGGTAAGAACGATATGGCACTGCATCTGCTGAGTGGCCT
TGATAGCAGCGGCGCGTTGTTGACCTTGCCACAGTGGGAGCCGGGGTTGGTGTTTGAAGTTAAAGCCCGC
CGTTTGAAGCTGTTGCGTATGAAGGCACAACGGGGTGACAGTGATAAAACCCGCCTGCATGCTGAAATGG
AAAGCCTGCTCGGTGGGCTTATCGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA