SecReT6
Protein ID: 170024823
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2598
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2855039..2855605 [-]
Producthypothetical protein
NoteTssC
UniProt IDB1JQM4
KEGG IDypy:YPK_2598
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-75, Aligned region: 1..177
Protein Sequence: 188 a.a.     [Download]
>gi|170024823|ref|YP_001721328.1| hypothetical protein YPK_2598 [Yersinia pseudotuberculosis YPIII]
MHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDNLVQDFEDAPEISQSGLYAQTYIQEYDTPGG
EPIAAAISNYEFDRGPQDIALLRNISKVAAAAHMPFIGSVGPAFFGKENMEEVAAIKDIGNYFDRAEYIK
WKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRSFTRLQQHAVCMGS
 
Nucleotide Sequence: 567 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2855605-2855039 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCACCACCCCGACTTCCAGCGGGTGGAATCGACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCG
ATTTCCGCCAGAACGTGCGCATCGAGCTGCTGGATATCAGTAAAGATAATCTGGTGCAGGATTTTGAAGA
TGCCCCGGAAATTTCACAAAGCGGTTTATACGCCCAGACCTATATTCAGGAATACGACACCCCCGGCGGT
GAACCGATTGCTGCGGCGATTTCCAACTACGAGTTTGACCGTGGCCCGCAGGATATCGCCTTATTGCGCA
ATATCTCCAAAGTGGCGGCTGCAGCCCATATGCCGTTTATCGGCTCAGTGGGTCCGGCGTTCTTTGGTAA
AGAGAACATGGAAGAGGTGGCGGCCATCAAAGATATCGGCAACTACTTTGACCGTGCCGAATACATCAAA
TGGAAAGCCTTCCGCGACTCGGATGATTCCCGCTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTT
TGCCTTATGGGCCAGACACCGTGCCGGTGCGCAGCTTTACCCGACTGCAACAGCACGCAGTCTGCATGGG
ATCTTAA