SecReT6
Protein ID: 170025766
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3551
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3909212..3910822 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1JKW1
KEGG IDypy:YPK_3551
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-43, Aligned region: 143..338
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 398..501
Protein Sequence: 536 a.a.     [Download]
>gi|170025766|ref|YP_001722271.1| hypothetical protein YPK_3551 [Yersinia pseudotuberculosis YPIII]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAW
DNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFN
GLQTPGSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLM
DLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNIL
TWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLAD
NATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3910822-3909212 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGTCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAG
AGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGG
GATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGC
GTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAA
GAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAAC
GGGCTGCAAACCCCAGGCTCCTACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTG
AGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTA
TGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATG
GATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACGCCACACAATCTTTGGCTATCGCGCAAG
CGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTG
CCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTG
ACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCC
TGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGC
GTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTG
GCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTT
CCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCAC
TCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGAC
AATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATG
CCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATA
G