SecReT6
Protein ID: 170025767
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3552
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3910819..3912174 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1JKW2
KEGG IDypy:YPK_3552
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|170025767|ref|YP_001722272.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQASGVFP
DGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAE
GTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTEL
LGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTI
PGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIF
TVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3912174-3910819 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCCAGCATTTTCAACAACAGG
AACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCTGGCATGGGGCTTCCATAG
CCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAGGCCAGTGGTGTTTTCCCT
GACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTGATCCGGGGGAGAACTGCC
AAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTATATTGATCTGAAGAAGAG
CAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAACCATGGCGTCGCTGCTGAA
GGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCACCTTACGTGCCAGCGTCA
GTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGATGGGCGTCTGATTCTGGA
TGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGATAATGCGGTAACCGAATTG
CTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGCTCTCAGTCGGTGGGTTAT
CGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAAGATTTCACATGTGTTGAT
GCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTGGGGCGTCTCAGTACTATC
CCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATGAACCGCACAACGGGTATT
TCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACCGGCAGTGGCGCTACCGTT
TATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGTCTGGAAAAACTGATCTTC
ACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGCAAACCAAACTGGGGCCGG
TGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGATCCCGATGTCATCACCGCC
AAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGATGATCCTATGTATAAAGAA
ATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGTTGCGTTTTGAAGTATGGG
GCTTGCGACAAGGAAGGCTCGGATGA