SecReT6
Protein ID: 170025768
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3553
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3912294..3912785 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDB1JKW3
KEGG IDypy:YPK_3553
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-17, Aligned region: 16..155
Protein Sequence: 163 a.a.     [Download]
>gi|170025768|ref|YP_001722273.1| putative lipoprotein [Yersinia pseudotuberculosis YPIII]
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIVELNKEG
WSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLMLKSD
ARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3912785-3912294 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCGTAGCCTCTTTCGTGTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGTGGCTGTAGCT
GGTTTTCCTCGTCCTCAGAAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCT
CATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCATTGTTGAGCTGAATAAAGAGGGA
TGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCG
TGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCG
CTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAATGCTGAAATCTGAT
GCTCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGT
AG