SecReT6
Protein ID: 170025776
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3561
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3923154..3924998 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JKX1
KEGG IDypy:YPK_3561
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-143, Aligned region: 6..609
Protein Sequence: 614 a.a.     [Download]
>gi|170025776|ref|YP_001722281.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHP
EFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQ
PLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTL
LNNTLHIVLWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGL
NDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLN
PRLYEVHHVIGVNGLLSEGGSVQFSSLHGHARFDDDDKVAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQ
LIANNPLRYALPDVTDCSTLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEAT
LDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3924998-3923154 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCCCAACGAAAGTTTTCTGGCTCTATACAACGAAGAGTTGCGTTATCTGCGTGAAGATGGGCAGCGCT
TCGCTCATATGCATCCGCAAGTCGCCCAACACCTTGGGTTACATGCTGATGGTGTGCTCGATCCTTTCGT
CGAACGGCTCCTTGAAGGCACCGCTTTCTTGAGTTCCCGTATCCAACAGCGTTTGAACAACGAGCATCCA
GAGTTTGCTTTGCAAATGCTTGGGCGTTTGGCCCCACTTTGGTATACACCCCTGCCGTCGATTGCCACCA
TTGCCATGGTTCCGGATCTTACGTCACCGCAATGGCACTCGCGCGTCGTATTGCCTAAAGGTAGCCGCGT
GACATTGAGTGACAGTTCGCTGAACAACCGGTTGGCGAATTTCTCTACTGGCCGCACGCTGAAAATACAG
CCATTGGTCATTGAAAATGCCGAGTGTGCCAGCACGCCACCGGCGTATTTACCGCTCTCTGTGGCTTCAC
AATTACAAGCTGGTCAGGCCCATCTGCGCTTGCGTCTGACCACTCAAGGTGTCGCGTCTTTATCTGAGCT
GGATTTCGCCCCGATGAACCTGACGCTGGCGGGGGGAATAATTCAGTCAAATCAGTTAATCACGACACTG
TTGAATAACACCTTACATATTGTTTTGTGGGCCAACACGGATGGGAAACCGCTGGTCAAAGTTCTTACCA
AAGAACATCTTCGCCAGGGAGGGCTGGATGAACAAGAGGCGCTTTTACCTGTTGCGATCAGCGAAATGCC
TGGAAACCGTTTGCTACGAGAATATTTTGCTGCTCCTTCGCGTTTTTTCGATCTGGAACTGCATGGCCTC
AACGACTTCCTGCAACAAGGGGACGGCATTCATACCTTTGAGGTGCTGTTTGTACTGGATCAGCGCCCCC
TACATTTGATTGATAGGGTCACTGGCAATGACTTCCGACTCTTCGCCACACCTATTATTAACCTGTTCAA
ACGCCGTTGTAGCCCGGTGCTGATTAATGGTGAACACACCGAATATCCCGTCATTGTTGACCCCCTGAAC
CCCCGCTTGTACGAAGTCCATCATGTAATCGGGGTCAACGGTTTGTTGAGCGAAGGGGGGAGCGTGCAGT
TTTCTTCCCTTCATGGTCATGCCCGTTTTGATGATGACGATAAAGTGGCGGGTTACAGCATTCGCCGTCG
CCGCGACTTCACGGATAAAAATCATCAGAAAAATTCACCTTTACCTCATGACAGCTTATTCATTGCCCTT
TCACCGGGGACCAGCGGGATAGATATTGATCACGTCAAGTCGCTGTCGATTGAAGCCATGGTGTGCGAAC
GCCACTTAATTCCCAGCCAATTACAGCATCCGGAATTCAAGCTGGAAATTGCCCTGCCAGTGGGGCAGAT
CGAAATGCTGCGTCACCCGGCAAAACCACAGGGTGTGCCGAATATTGATCAAGCCTGGCGGGCGTTACAA
CTGATTGCCAACAATCCGCTGCGTTATGCGCTGCCGGATGTCACCGATTGTTCGACGCTGCTAAAAGATT
GGCTGTCGATATTTTGTCAGCATGAAGAGGCGAGCCAGCATAAGAGGATCACTAGCCTGACTCACGCCAG
TGTGGCGCATAATTTTGAACGTCATACCGCTCCGGGGCCGATCGCCTGGAGCCGGGGGGTTGAAGCCACA
CTGGATTTCAACAGCAGCCACCACAGTGATAAAGGTGCATTCCTCTTTGCGCGGATCCTGCATCACGCGC
TGTCAGAATATTGTGAATTAGGGCAGACCCTGAGGTTACACATGCAGGTTGATGGTGAAACCTTCGCCAA
ATGGGGGCCTGTCAACTATGGCTAG