SecReT6
Protein ID: 170025779
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3564
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3926229..3927740 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1JKX4
KEGG IDypy:YPK_3564
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-184, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|170025779|ref|YP_001722284.1| EvpB family type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVKVNRDVVLTIE
SLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAW
DQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWR
ELGNPRDIGKIFTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFT
WANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNA
GFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRL
VSKLPSNKESEKK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3927740-3926229 Yersinia pseudotuberculosis YPIII chromosome, complete genome
GTGGAGAACATGCAGAAAGCCCAACTCAATGACACGCCAGACATCAACGTCGATCTGGCTGAAAACGAGT
TAGATGACATTTTAAAACGTTCTTTTCGCCCTCGAACTGACGAAGCTTCCGCCACAGTGCGCCGTGCCAT
AGGCACGCTTGCTGCGTATGCCAATAAAGGCCAAGTGAAAGTCAATCGTGATGTCGTACTGACCATTGAG
TCTTTAGTCGCTGAAATTGACGAAAAACTTTCCGATCAAATGAACCTTATTCTGCACCATAAAGAGTTCC
AAAAGCTGGAATCAGCTTGGCGCGGGCTTAGCTATCTTGTTGATAATACAGATGCTAATGAAACTTTAAA
AATACGGGTACTGAACATTAGCCAAGATGAACTGGGGAAAACGCTTCGCCGTTATCGTGGCTCTGCATGG
GATCAAAGTCCGATATTTAAACAGGTCTATGAACATGAATATGGGCAGTTTGGTGGGGAACCTTTTGGTT
GCATGATCGGTGATTATGAATTCGATCACAGTCCACAGAGTGTGGCTCTGCTGACCGAGTTAGCCAAGGT
GGCCGCCGCCGCTCACTGTCCTTTCATTACCTCTTCTTCCCCAAGCATCATGCAGATGAATAACTGGAGG
GAGCTGGGTAACCCAAGGGATATCGGCAAAATTTTTACCACACCTGAATATGCGCCATGGAGACGTTTAC
GTGAGAGTAATGACTCCCGCTATCTGGTACTGACTCTGCCACGTTTTCTTTCGCGTCTGCCGTATGGTGC
CAAAAATCATCCTATTGATGATTTTGCTTTTGAAGAAGTGGTTAGCCCTCATGCCAGTGAGGATTTCACT
TGGGCGAATGCGGCCTATGCCATGGGCGTCAATATTAACCGGGCCTTCAATGAATATGGTTGGTGTTCAA
GGATCCGCGGTATTGAGTCGGGGGGGTCCGTAGAAGAACTTCCGGCCTATGCTTTTCCTTCTGACGAAGG
CGGATATGAACTCACTTGTCCGACAGAATTGGCAATTTCGGACCGTCGTGAGAACGAGCTATCCAATGCT
GGGTTTTTACCGCTGGTCTACCGTAAGAACTCAGACTTTGCCGCCTTTATCGGGTCGTGCACCCTGCATG
CACCGGCAAACTATGATGACCCCGATGCGACGGCGAACGCCAGATTATCGGCCCGTTTACCTTACATTTT
TGCCACCTGTCGTTTCGCCCATTACCTCAAATGTATTGTGCGCGACAAAATTGGTTCGTTCCGCTCGCGG
GATGACATGCAACTTTGGCTTAACGACTGGGTGATGAACTACGTCGATGGTGACCCCTCCATTTCAACAG
AAGCCACTAAAGCTAAACGCCCGCTGGCCGCTGCGGAAGTTCAAGTTGAAGACGTAGAGGATGATCCTGG
TTTTTACCGCGCTCACTTCTATTTACGCCCTCACTACCAACTTGAAGGTATGACGGTTTCTCTGCGGCTG
GTTTCTAAACTTCCATCCAACAAGGAAAGCGAAAAGAAATAA