SecReT6
Protein ID: 170025780
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3565
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3927740..3928300 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1JKX5
KEGG IDypy:YPK_3565
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-57, Aligned region: 11..165
Protein Sequence: 186 a.a.     [Download]
>gi|170025780|ref|YP_001722285.1| type VI secretion protein [Yersinia pseudotuberculosis YPIII]
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDRKFLTFDQDNF
DARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGK
TSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVEDDDGEK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3928300-3927740 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGCCAAAGATGCGAGCTCGCAAAAATTTATCGGTAGAAATAATGCACCTAGAGTGCAAATTGAATATG
ACGTCGAAATTTATGGTTCAAATAAGAAAGTAGAGTTGCCTTTTGTAACCGGCGTGATGGCTGATCTTTC
TGGCCACAGGGCAAAGCCTCTTCCCGCCGTTGAAGATCGTAAATTCCTTACTTTCGATCAGGATAATTTC
GATGCCCGGATGAGAGCAATTAAGCCTCGCCTTAAATTCTACGTAGATAACACCTTGAGTGAGGATAACG
AACTCCTGGATATCGAACTGGATTTTGAGTCAATGGATGACTTTTCTCCCGGATCGTTAGCGCGGCGTAT
TCCTCAAATGGAAAAACTGCTTGAGGCACGTACCCATCTGGCTGAATTGATCACCTATATGGATGGTAAA
ACCAGCGCAGAAGAGGTGGTTAAACAACTGCTTGAACAACCTGATTTTTTACAAAATCTTGCGACCGATG
CACAGGGAACTATTTCGAAGCTCAGCCAGGATGATGATGTTTTAGTGGAAGATGACGATGGAGAAAAATA
G