SecReT6
Protein ID: 170025781
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3566
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3928311..3929297 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1JKX6
KEGG IDypy:YPK_3566
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 45..102
ImpA-rel_N [PF06812], Evalue: 3.10E-08, Aligned region: 174..194
Protein Sequence: 328 a.a.     [Download]
>gi|170025781|ref|YP_001722286.1| ImpA domain-containing protein [Yersinia pseudotuberculosis YPIII]
MSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCFDLRVMLWFI
RANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTEEHPY
ILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHC
EQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHY
EPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 987 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3929297-3928311 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATGATCCGGCCTATGGCGAGATTGAGTCCA
TCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCCGCATGAACCCCCTCAAATAAACTGGCA
CCATATCAGTGAGCAAGCCAATAAGCTGCTAGAACAATGTTTTGATTTACGTGTAATGCTTTGGTTTATA
AGGGCAAATATTCATATAAAAGGAATCTCGGCCCTCTATGATGGCTTTATGCGCATTAATGCACAAACCC
AAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCCATTAAATAGTGGGCATGCCGCCGCATT
AGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACTGCACGCCTTACAGAAGAGCACCCTTAC
ATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGTCAAGAGAGATATTTTGTTACATCTTCGA
CATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATTGCCAGATTTAAAAGACCAATTGACAAA
AGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAATCCACAGAGAGTTACCAACTGCATTGT
GAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTGCACAATTGAATGCCCCAGAACATGACG
ATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCTTGATACTCAGTCCTTTAATTCAAATGA
TAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGACCGTATTCTAGAGTATTTTCAACATTAT
GAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAGAGATGATAGGTATGGATTTTTATTCCA
TTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACAGTTTACCGGAAAAACTAACCTACCGTT
TCGATGA