SecReT6
Protein ID: 170721678
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2497
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2772239..2773333 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB1J8G4
KEGG IDppw:PputW619_2497
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 242..257
Phage_lysozyme [PF00959], Evalue: 0.0039, Aligned region: 48..116
Protein Sequence: 364 a.a.     [Download]
>gi|170721678|ref|YP_001749366.1| ImpA family type VI secretion-associated protein [Pseudomonas putida W619]
MPEFLNGLSLAELAAPIDGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEKVINLSAQGL
EQQSKDLMLVAWLNEGLAQRDHFQGITFGLTLCERILETFWETAYPSLEDGLDERAARLSWLKTTLTDIV
GGLPITQGQNFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVVLSDTEHLQAKAVEIAASL
QACQRLQATTDRLFGTEAPSFASLADMLSRASQLAEKLLKDRGIELHPVAAEPEPAVTLSAASEPGEPMN
TPVQAAAPAPMRTTPLTRDEAFTMLAGIAQFFKQTEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNVV
DNIRDVLGTREQRS
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2773333-2772239 Pseudomonas putida W619 chromosome, complete genome
ATGCCTGAATTCCTCAACGGCCTTTCGCTGGCCGAGCTGGCCGCGCCGATCGACGGTGGCAGCGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCGCGCCGGGCAGACCCTGACTACCTGACCCA
GGGCGACTGGCAGACCGACCTGAAAACCGCCGACTGGGAAAAGGTCATCAACCTGTCGGCCCAAGGGCTT
GAGCAGCAGAGCAAGGACCTGATGCTGGTCGCCTGGCTCAACGAAGGCTTGGCCCAGCGCGATCACTTCC
AAGGCATCACCTTCGGCCTGACCCTGTGCGAACGCATCCTGGAAACATTCTGGGAGACCGCCTACCCGTC
ACTCGAAGACGGCCTGGACGAGCGCGCTGCGCGGCTGTCCTGGCTCAAGACCACCCTCACCGACATTGTC
GGTGGCTTGCCCATTACCCAAGGGCAGAATTTCGGCGTGCTGCGTTACGACGAATCACGCCATGTAGAAA
ACCTTGCCTTGCAGAACCCCAAGGCGATGCAAACCGCGCTCAATGAGGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTGGTGCTCAGCGACACCGAGCACCTGCAGGCCAAAGCGGTGGAGATTGCCGCCAGCCTG
CAGGCCTGCCAACGCCTGCAAGCGACCACCGACCGCCTGTTCGGTACCGAAGCGCCAAGTTTTGCCAGCC
TCGCCGACATGCTGTCGCGGGCCAGCCAACTGGCAGAGAAACTGCTCAAGGACCGCGGCATCGAACTGCA
CCCTGTCGCCGCAGAGCCAGAGCCTGCCGTCACCCTCAGCGCAGCCAGCGAGCCAGGTGAACCTATGAAT
ACGCCCGTTCAGGCCGCAGCGCCTGCGCCCATGCGCACCACGCCACTGACCCGCGACGAAGCCTTCACGA
TGCTCGCCGGCATTGCCCAGTTCTTCAAACAGACCGAGCCGCAAAGCCCGGTACCGTACCTGATAGAGCG
CGCCATCAAGTGGGGCAACATGCCGCTCGAGGGCTGGCTGAGCGATGTGATCAAGGACAGTAATGTGGTG
GACAACATCCGCGACGTGCTGGGGACACGTGAGCAGCGCTCCTGA