SecReT6
Protein ID: 170721683
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2502
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2781324..2782040 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1J8G9
KEGG IDppw:PputW619_2502
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-53, Aligned region: 20..221
Protein Sequence: 238 a.a.     [Download]
>gi|170721683|ref|YP_001749371.1| hypothetical protein PputW619_2502 [Pseudomonas putida W619]
MTEAVLQQGAVAPASDKPTLKGLVQDFISMALIVRRGRQVTSVQAFEASVDRFFANLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSGDNELRGHFELQPLQFRYFGVHLAGEGFFEKVEALRADVKQNLDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANALGQDIARYRKPPKTLSPDWALPDQVSQMLRHEVPLWVYLVLIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2782040-2781324 Pseudomonas putida W619 chromosome, complete genome
ATGACCGAAGCCGTATTGCAACAGGGCGCCGTTGCGCCCGCCAGCGACAAACCGACCCTCAAGGGCCTGG
TACAGGACTTCATCAGCATGGCGCTGATTGTCCGCCGTGGCCGCCAGGTCACGTCAGTACAAGCCTTCGA
AGCCAGCGTCGACCGCTTCTTCGCCAACCTGGAGCGCGATGCCCGCGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCCCTATGCGCGTTCCTCGACGAAAGCGTGCTGCGCTCCGGCGACAACGAAC
TGCGCGGGCACTTCGAGCTGCAACCGCTGCAGTTCCGCTACTTTGGCGTGCACCTGGCCGGTGAAGGCTT
CTTCGAGAAGGTCGAAGCGTTGCGCGCCGACGTCAAACAGAACCTCGATGTGCTGGAGGTCTACCACCTG
TGCCTGGCGCTGGGTTTCGAGGGCAAGTTCAGCCTCGGCCAGAAAGACCAGCTGCGCTACCTGGCCAACG
CCCTGGGCCAGGACATCGCGCGCTACCGCAAACCACCCAAAACCCTCTCGCCGGACTGGGCCCTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCACGAAGTACCGCTGTGGGTGTACCTGGTGTTGATTGCGCTGGTCTGT
GTCGCGGTGTACCTGACGCTCGACTGGTTGCTGGACAAGGATGTCGCCGCCCTTTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA