SecReT6
Protein ID: 170721684
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2503
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2782037..2783380 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1J8H0
KEGG IDppw:PputW619_2503
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|170721684|ref|YP_001749372.1| type VI secretion protein [Pseudomonas putida W619]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRGTPFHWGVQALQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGQEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLAKLTRNSMGGFNLDPHFVHPTLHLGSHETLAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSYWQGQLRDPRLAEADFYI
SVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGHVYER
MMNAQTICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2783380-2782037 Pseudomonas putida W619 chromosome, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAATACCAGG
ATGAGTTCCACCAGCACCAGCTGGCCGAGGCCACCCTGCGCGGCACCCCGTTCCATTGGGGCGTGCAGGC
GCTGCAGGTGGACGAAGATGCCCTGGCCAATGGTTCGCTGCAGCTCAAGCGCCTGAAACTGGTGTTTCCG
GACGGCAGCCTGTACGACGCGCCGCAGCACGACCCGCTGCCGGCCGCGCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTGAAGGTTTACGCCGCACTCAAGCTGCCCGAGCCCTTCGGCCTGAACTATGTCGAAGA
TGGCCAGGAGCACAAGGCGGCGCGGCGCTTTCGCAAGCAGTTCGACACCCTGCCGGACCTTAACGAAGGT
GAACTGGAAAACGAAATCACCAGCCTGCGCCTGAATGTGGTGCTGCTGGTCGATGGCGACAGCCTCGATG
GCTACAGCCATTGCCCGTTGGCCAAACTCACCCGCAACAGCATGGGCGGCTTCAACCTGGACCCGCACTT
CGTCCACCCCACCCTGCACCTGGGCAGCCACGAGACCCTGGCCGGCATCGGCAAGCGCCTGCTCGGTGCC
CTGCAGGCCAAGAGCAAGGCGTTGTCGGGCCGGCGCCGTGAGCGCGCCGACCAGATCGCCGAATTCGGCT
CCAGCGACGTCACACTGTTCTGGTTGCTGAACACGGTCAACCGTGCGCACCCGCAACTGGCCCACCTGCT
GGCCCACCCGCGGCTGCACCCCGAGCGCCTGTACCTGTTCCTGGCCGACCTTGCCGGCGGGCTGTTGACG
TTCACCCTCGACACCCAGCTTAGTGATATCCCCGAATACGATCACCACGACCCGGCGGCATCACTGGTCA
AACTGGACGAGATGATCCGGGTGATGCTCGACAATGTCGTGCCCAACCAGTGCATCGTCATCAACCTCAC
CCAGACCAAGCCGTCGTACTGGCAGGGGCAACTGCGCGACCCGCGCCTGGCCGAGGCCGACTTCTATATC
TCGGTACACGCCGACATGCCAGGTGCCAGCCTGCTGGAGCTGGTGCCACGGGCGTTCAAGGTTGGCTCGC
CGGAAGACATCGAAGTGGTGGTCAACAGCGCCATGCCCGGCGTCACCCTCAACCATGCTGCGCGGTTGCC
CAACGCCATTCCGGTACGCCTGGACAACCAGTACTTCGCCATCGAGCCGCATGGCCATGTTTACGAGCGA
ATGATGAACGCCCAGACCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA