SecReT6
Protein ID: 170721685
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2504
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2783377..2784099 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDB1J8F3
KEGG IDppw:PputW619_2504
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.40E-35, Aligned region: 17..172
Protein Sequence: 240 a.a.     [Download]
>gi|170721685|ref|YP_001749373.1| putative lipoprotein [Pseudomonas putida W619]
MYHTHTALKRLTVAALLLALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPEKALGNTLVEARELTLLPGIGQTDQWPLAKTARYVGVAAFFRNEQD
ARWKVAFDAESLRKDGIWFSSDGLRVLVDNTEISALRGVDVLNKPPTADQLAAAQKADDTPPALTDKVQD
AVIEKATDAAGKSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2784099-2783377 Pseudomonas putida W619 chromosome, complete genome
ATGTACCACACACACACCGCCCTGAAGCGCCTGACCGTCGCAGCCCTGCTGCTGGCACTGGCCGGTTGCG
GCGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGATATGCTGGCCGACAGCGAGAA
GGTCATCCTGACCTCCGACGGTGGTAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGTTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACCGACCTCGAGCGCTTTGCAGCCACCGACGCCGAGACACTTTGGGACACAC
CGGAAAAAGCCCTAGGCAACACGCTGGTCGAAGCCCGCGAGCTCACCCTGCTGCCGGGTATCGGCCAGAC
CGACCAGTGGCCGCTGGCCAAGACCGCCCGCTATGTCGGCGTGGCAGCGTTCTTCCGCAATGAGCAGGAT
GCCCGCTGGAAGGTCGCATTCGATGCCGAGTCGCTGCGCAAGGACGGTATCTGGTTCTCGTCCGATGGCC
TGCGGGTACTGGTGGACAACACCGAAATCAGCGCCCTGCGTGGCGTCGATGTGCTGAACAAGCCGCCCAC
CGCCGACCAGTTGGCTGCTGCGCAAAAGGCCGACGATACGCCGCCTGCCCTCACCGACAAAGTGCAGGAC
GCCGTGATCGAAAAGGCCACCGACGCTGCCGGTAAATCGGCCAGCAACGCCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA