SecReT6
Protein ID: 170721686
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2505
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2784125..2786722 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1J8F4
KEGG IDppw:PputW619_2505
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 34..46
AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 225..242
AAA_2 [PF07724], Evalue: 1.80E-43, Aligned region: 596..763
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 61..79
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 602..720
ClpB_D2-small [PF10431], Evalue: 1.20E-14, Aligned region: 772..843
AAA_5 [PF07728], Evalue: 3.30E-14, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 3.30E-14, Aligned region: 298..355
AAA_5 [PF07728], Evalue: 3.30E-14, Aligned region: 601..722
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 224..308
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 342..417
AAA_22 [PF13401], Evalue: 3.00E-10, Aligned region: 599..638
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 113..155
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 463..517
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 596..642
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 7.70E-09, Aligned region: 787..808
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 221..241
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 601..728
Clp_N [PF02861], Evalue: 1.80E-06, Aligned region: 21..73
Clp_N [PF02861], Evalue: 1.80E-06, Aligned region: 103..124
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 600..642
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 667..695
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 225..247
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 599..623
AAA_17 [PF13207], Evalue: 1.50E-05, Aligned region: 225..319
AAA_17 [PF13207], Evalue: 1.50E-05, Aligned region: 602..639
AAA_14 [PF13173], Evalue: 2.70E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 2.70E-05, Aligned region: 600..682
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 225..252
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 292..327
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 601..626
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 709..733
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 225..291
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 350..381
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 475..495
AAA_25 [PF13481], Evalue: 7.50E-05, Aligned region: 599..625
IstB_IS21 [PF01695], Evalue: 8.70E-05, Aligned region: 219..246
IstB_IS21 [PF01695], Evalue: 8.70E-05, Aligned region: 601..620
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 599..626
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 220..247
Zeta_toxin [PF06414], Evalue: 0.0013, Aligned region: 595..641
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 225..251
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 603..626
RNA_helicase [PF00910], Evalue: 0.0089, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.0089, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.0089, Aligned region: 702..720
Protein Sequence: 865 a.a.     [Download]
>gi|170721686|ref|YP_001749374.1| type VI secretion ATPase [Pseudomonas putida W619]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDNSDSDLPLILRHYDVVAERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWVLASIEYGVGQVRSAHLLQALLDDAELRRVVIASAPELEKINA
DDLRLNLSALVEGSAESRLASPLASPSAPVAGAGKVGGKTPALDQYTVNLTQSARDGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAPLKDVAVHTLDLGLLQAGAGVKGEFENR
LKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTAC
ARIALAQSSQPGALEDCRRHIDNLQAEIAVLDHEAGKGHDHARRLAELQAALQAEQSHEQRLSAQWQQEL
GLVEQLKALDSAKDTDAAQLNALRAELSAVQGDQPLVHALVDAGAIAQVISGWTGIPLGKMLRDEIDTVQ
RLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLI
TINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLD
DGEGREINFRNTVIILTSNTGTERIMQTCLNAQTLPTPEAIVEGLRDELNHVFKPAFLGRLSIVPFYPVQ
DQILERIVALKLERIAKRFARNHQAELSYDDALVKAIAARCTEVDSGARNIDNILSRTLMPELAQHVLER
MAQDAPIERLTIELGSDGDFAYRLA
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2786722-2784125 Pseudomonas putida W619 chromosome, complete genome
GTGAACCTGAAGTCTCTGTTCGCCAAGCTTAACGAAACCAGCCGCACGGCCACTGAAAGCGCGGCGGCCC
TGTGCCTGTCGGAGCACCACTACGACGTCGAGGTGGAACACCTGCTGCTGCAGTTGCTGGACAACAGCGA
CAGTGACCTGCCGCTGATCCTGCGCCACTACGACGTGGTCGCCGAGCGCCTGCAGGCGCAACTGGTGACC
GCCCTGGGTACCTTCAAGAAGGGCAACACCCGCACCCCGGCGCTGTCCCCGCACATCACCCGCATGATCG
AGCAGGCATGGGTACTGGCCTCGATCGAGTATGGTGTGGGCCAGGTGCGCAGTGCGCACCTGTTGCAAGC
ATTGCTCGACGACGCCGAACTGCGCCGGGTGGTCATCGCCTCCGCACCGGAGCTTGAGAAGATCAACGCC
GACGACCTGCGCCTGAACCTCAGCGCACTGGTCGAAGGCAGTGCCGAATCCCGGCTCGCCAGCCCTCTGG
CCAGCCCCTCGGCGCCAGTGGCAGGCGCCGGCAAGGTTGGCGGCAAGACCCCGGCCCTGGACCAGTACAC
CGTCAACCTCACACAAAGCGCCCGTGACGGCCGGATCGACCCGGTGCTTGGCCGCGAGTTCGAAGTGCGG
CAGATGGTCGACATCCTCACCCGTCGCCGCCAGAACAACCCGATCCTCACCGGCGAAGCCGGCGTCGGCA
AGACCGCAGTGGTCGAAGGCCTGGCCTTGCGCATCGCCCAGGGCGATGTGCCAGCCCCACTCAAGGACGT
CGCCGTGCACACCCTCGACCTGGGCCTGCTGCAGGCGGGTGCCGGGGTCAAGGGCGAGTTCGAAAACCGC
CTCAAAGCGGTGATCGAAGAGGTCAAGCGCAGCCTGCACCCGATCATCCTGTTCATCGACGAAGCCCACA
CCCTGATCGGCTCCGGTGGCCAGGCCGGGCAGAACGATGCCGCGAACCTGCTCAAGCCAGCCCTGGCCCG
TGGCGAGCTGCGCACCATCGCTGCCACCACCTGGGCCGAATACAAGAAGTACTTCGAAAAAGACGCCGCC
CTCGCCCGTCGCTTCCAGGTAGTCAAGGTCGAAGAGCCTGACGAAGACAAGGCCATCCACATGCTGCGCG
GCCTGCTCGGCAAGATGCGCGAGCACCACAAGGTGGCGGTGATGGACGAAGCACTGGTACAGGCCGTGCG
CCTGTCCAACCGCTACATCACCGGCCGCCAGCTGCCCGACAAGGCGGTCAGCGTGCTCGATACCGCCTGC
GCACGCATCGCCTTGGCGCAGTCGTCGCAACCCGGCGCGCTGGAAGACTGCCGCCGCCATATCGACAACC
TGCAGGCCGAAATCGCCGTGCTCGACCACGAAGCCGGCAAGGGCCACGACCATGCCCGGCGCCTTGCCGA
GCTGCAGGCCGCCCTGCAGGCCGAGCAGTCGCACGAACAGCGCCTGAGCGCCCAGTGGCAGCAGGAGCTG
GGCCTGGTCGAGCAACTCAAAGCCCTGGACAGCGCCAAGGACACCGACGCCGCCCAGCTCAACGCCCTGC
GCGCCGAGCTGAGCGCCGTCCAGGGCGACCAGCCCCTGGTCCACGCCTTGGTCGATGCCGGCGCCATCGC
CCAGGTGATCAGCGGCTGGACCGGTATCCCGCTGGGCAAGATGCTGCGTGACGAGATCGACACCGTGCAG
CGCCTGCCTGCGCTGCTCGGTGAACGCGTGCTGGGCCAGGACCACGCGCTGCACGAAATCGGCAAGCGCA
TCAAGATTTCCCGCGCCCGCATGGAAGACCCAAACAAACCGATCGGCGTGTTCCTGCTGCTGGGCCCCAG
CGGCGTCGGCAAGACCGAAACCGCGCTGGCATTGGCCGACACCCTGTACGGCGGTGAGCGCAACCTGATC
ACCATCAACATGTCCGAGTACCAGGAGGCCCACACCGTATCGAGCCTCAAAGGCTCGCCACCCGGCTACG
TCGGTTACGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGCCGCAAGCCCTACAGCGTGGTGCTGCTCGA
CGAGGTGGAGAAGGCCCACCCCGACGTGCTCGAGCTGTTCTTCCAGGTGTTCGACAAAGGCGTGCTGGAC
GACGGCGAAGGCCGCGAGATCAACTTCCGCAACACGGTGATCATCCTCACGTCCAACACCGGCACCGAGC
GCATCATGCAGACCTGCCTGAATGCCCAGACGCTGCCTACCCCCGAGGCCATCGTCGAAGGCCTGCGCGA
CGAGCTGAACCACGTCTTCAAACCGGCCTTCCTCGGCCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAG
GACCAGATCCTCGAGCGCATCGTTGCCCTCAAGCTCGAGCGTATCGCCAAACGTTTCGCCCGCAACCACC
AGGCTGAGCTGAGCTACGACGACGCCCTGGTCAAGGCCATCGCGGCACGTTGCACCGAGGTCGACAGCGG
CGCACGCAACATCGACAACATCCTGTCCCGCACCCTGATGCCCGAGCTTGCCCAGCACGTTCTCGAGCGC
ATGGCCCAGGACGCGCCGATCGAGCGCTTGACGATCGAGCTGGGCAGCGATGGCGATTTCGCCTATCGCC
TGGCCTGA