SecReT6
Protein ID: 170721687
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2506
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2786719..2787789 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1J8F5
KEGG IDppw:PputW619_2506
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|170721687|ref|YP_001749375.1| type VI secretion protein [Pseudomonas putida W619]
MASTYWRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LQFEREGKVSTAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQQLKFERQQPVLRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVRQFAGRWLNLQPEQCTQLGRKNAQLGISAVAGNRVWDYQSCIRIELGPLALADYRRFQP
GTDDYRKLVELVRFYVGAELDFEIAPLLRREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2787789-2786719 Pseudomonas putida W619 chromosome, complete genome
ATGGCCAGCACGTACTGGCGATCAGCCCCTGGTCTGATCGATCAAGCCAGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGTCTGCTTCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTCCGCACTCAGCTGTCGCTGGCGTTTCCGGCCAGCGAGGTCAGCGAC
CTGCAGTTCGAGCGTGAGGGCAAGGTGTCGACGGCCGGCCTGCCGCTGTCGGAAGTCCAGGTCACTTTCA
TGGGCCTGGTAGGCCCGTCGGGCGTATTGCCTCGCCCGTACACCGAGCTGCTGCTCGAGCGCCACGTGCA
GTACCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAA
GCCTGGCAAAAGTACAAATTCCATATCGAGCACGAGCGCAACGGCACCTCGGGCTTCGATGGCTACCTGC
TCAACCTGGTCGGCCTGGGCCCGCGCGCCCAGCAGCTGAAGTTCGAACGCCAGCAACCGGTGCTGCGCCG
CGAGCTGTTCAGCTACTTTGCCGGGCTGCTCAGCCAGAAGCCACGCAACGCGCTGAACCTGGAGCGGATG
CTCGGCTTCTATTTCTCCCTGCCGATCAAGGTCAGGCAGTTCGCCGGCCGTTGGTTGAACCTGCAGCCCG
AACAGTGCACCCAGCTTGGCCGCAAGAACGCCCAGCTCGGCATCAGCGCCGTGGCCGGCAACCGCGTGTG
GGACTACCAGTCGTGCATCCGTATCGAGCTCGGCCCCTTGGCGTTGGCCGATTACCGGCGGTTCCAGCCT
GGCACCGACGACTACCGCAAGCTGGTCGAGCTGGTGCGCTTCTATGTAGGCGCCGAGCTTGATTTCGAAA
TCGCCCCGCTGCTCAGACGCGAAGCCGTGCCCCGTGCCCAACTGGGCCGCAGCGGCAATGTCGCGCTGGG
CTGGCTGGGCTGGCTCAAACGCCCTGGCCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA