SecReT6
Protein ID: 170721688
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2507
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2787753..2789573 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1J8F6
KEGG IDppw:PputW619_2507
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-212, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|170721688|ref|YP_001749376.1| type VI secretion protein [Pseudomonas putida W619]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGKQEKVTEAYRVARHTEMHANAVEGVVCKFRTCYPVELWPVAV
QQASFTEMERSAFNGHSADLVARLRIRLQATGDVLFGQMELDRLRFFLDGEATLMHQLYELLFNNLAKAT
LSFQDEGRSREVALPAGALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVEINFYFNDYDLSERLARLAQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDIRLHNAA
EVVSIDRVRRVRKLGGIDHVGTCQPFFEPRGEQDPHNSFWIARRRNQGDATAMSIRVVDRDLELIDGTSD
TLSISLTCSNRDVPLLLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHLSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTFDESQFTGSGVF
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2789573-2787753 Pseudomonas putida W619 chromosome, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CTGCGCAGTACCCGAAAATCGCCTCGCGGCTGCTGATCGAGGGCGACAACTGTGAGGACCCGCATACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTCTCGGCGCGGGTGCACAAAAAGCTCGATGACGAGTTCCCGGAG
ATTGTCGAGTCGTTCCTTGAGGTGCTGTACCCGCACTACCTGCGCCCTACCCCGTCGATGTCGATCGCCG
AGCTTAGCCTTGGCAAGCAGGAGAAGGTCACCGAAGCCTACCGCGTGGCGCGGCACACCGAGATGCATGC
CAATGCCGTTGAAGGCGTGGTTTGCAAGTTCCGCACCTGCTACCCGGTGGAGCTGTGGCCGGTTGCCGTG
CAGCAGGCCTCGTTCACCGAGATGGAACGCTCGGCCTTCAACGGCCACAGCGCCGATCTGGTGGCGCGCT
TGCGCATCCGCCTGCAAGCCACCGGCGACGTCTTGTTCGGCCAGATGGAGCTTGACCGCCTGCGCTTCTT
CCTCGACGGCGAAGCAACGCTGATGCACCAGCTCTACGAGCTGCTGTTCAACAACCTCGCCAAGGCCACA
CTCAGCTTCCAGGACGAAGGCCGCAGCCGTGAAGTCGCACTGCCCGCCGGCGCCCTGAAAGCGGTGGGTT
ATGCCCGCGACGAAGGTCTGGTGGATTACTCCGAGCGCTCGTTCCTCGGTTACCGCCTGCTGCACGAGTA
CTTCACGTTCCCCGACAAATTCATGTTCTTCGACCTCTCAGGTTTTGCCCGCATCCTGCAGGGCAAGGCC
ATCGAGCAGGTCGAGATCAACTTCTACTTCAACGATTACGACCTCAGCGAGCGCCTGGCGCGGCTGGCCC
AGAACATCGGGCGCAACAATTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTCACCCACACCCAGCACGAATACCCGGTCACCCCGGACATTCGCCTGCACAACGCGGCG
GAAGTGGTGTCGATCGACCGGGTGCGGCGCGTACGCAAGCTCGGTGGCATCGACCACGTCGGCACCTGCC
AGCCGTTCTTCGAGCCGCGTGGCGAGCAAGACCCGCACAACAGCTTCTGGATTGCCCGCCGGCGCAACCA
GGGCGATGCCACGGCGATGAGCATCCGCGTGGTCGACCGCGACCTGGAGCTGATCGACGGCACCAGCGAC
ACCCTGAGCATCAGCCTGACCTGCAGCAACCGTGATGTACCCCTGCTGCTGCCGTTCGGTGGCGAGCGCG
GTGATTTCAACATCCCGGCCAACTCGGTGATCAAAGACATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGCGTCCCGCTGGGCAAAGGCCTGATCTGGCGGCTGATCGCGCACCTGTCGCTCAACCACCTGTCGCTG
GTGAGCCAGGGCCGCGAAGTGCTGCTCGAGCTGCTGTCGCTTTACAACTACCGCAACGTCTCGGCCATCC
GCAAACAGATCAACGGCATCAAGGCAATCAGCAGCGAGCCGGTGGTAGCGCGCATCGGCCACCCGCGGCC
GAATTTCGTGCGCGGCGTGGGCATCACCCTGACCTTCGACGAAAGCCAGTTCACCGGTAGCGGCGTGTTC
CTGTTCGGCATGGTGCTGGACCACTTCTTTGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGTACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGTACTGGCGATCAGCCCCTGGTCTG
A