SecReT6
Protein ID: 170721689
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2508
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2789573..2790055 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1J8F7
KEGG IDppw:PputW619_2508
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|170721689|ref|YP_001749377.1| type VI secretion system lysozyme-like protein [Pseudomonas putida W619]
MSNQARLLPSLLDRLLDDRPFQSAEPAVQRTCSLAEYKASIVRDLEVLVNTRQSLVAEQIEGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2790055-2789573 Pseudomonas putida W619 chromosome, complete genome
ATGAGTAATCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGGCTGCTGGACGACCGTCCGTTTCAGTCGG
CCGAGCCGGCTGTGCAGCGCACCTGCTCGCTGGCCGAATACAAGGCCAGCATCGTGCGCGACCTGGAGGT
GCTGGTGAATACCCGCCAGTCCCTGGTCGCCGAGCAGATCGAAGGTTTCAGCCAGCTCGGTGGCTCCATC
CTTGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCGCACGACCGGCGGCTGATCCAGC
AACAGCTGGAGCGCGCGATCAGTACCGGCGACCGGCGTTTTCGCCGGGTGCGCGTACAGCTGCTGGCCCA
GCAGAACGGCCATCGCATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCGTTTGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA