SecReT6
Protein ID: 170721690
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2509
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2790082..2791584 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1J8F8
KEGG IDppw:PputW619_2509
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.10E-197, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|170721690|ref|YP_001749378.1| EvpB family type VI secretion protein [Pseudomonas putida W619]
MTDKQTLPQQDTDLVEVETFAPQASLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDARIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASPELFGWDSF
TDMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFSRYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2791584-2790082 Pseudomonas putida W619 chromosome, complete genome
ATGACCGACAAGCAAACACTGCCACAACAGGACACCGACCTGGTCGAGGTGGAAACCTTCGCCCCGCAGG
CCTCGCTGCTCGACAGCATCATTTCGCAAAGCCGTGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
TGACCTGATCGGTGAGCTGGTCAACCAGGTGCTCGAGGGCGAGATGACCCCGAGCAAGGACCTGATCGCT
GTGCTGGACGCGCGCATCGCCGAGATCGACTCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAATTCCAGCAGCTGGAAGCCTCGTGGCGCGGCCTGAAGTATCAGGTCGACCAGACCGAAACCAGCAC
CACGCTGAAGATCCACCTGCTCAACGCCTCGAAGAAGGACCTGGTGCGCGACCTCAAGGCCGCCAGCGAA
TTCGACCAGAGCGCGCTGTTCAAGAAGGTATACGAAGAAGAGTACGGCACCTTCGGTGGCGCCCCGTTCG
GCATGCTGATCGGTGACTACGAATTCAACCGCAACCCCGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTGGCCGCCGCGGCCCATGCGCCATTCATCTCGGCCGCATCGCCCGAGCTGTTTGGCTGGGACTCGTTC
ACCGATATGTCCGGCCCGCGTGACCTGGCGAAAATCTTCGACACGGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAGGACTCACGCTATGTCGGCCTGACCCTGCCGCACGTGCTAGGCCGCCTGCCATATGG
CCCTGATACCACCCCGGTGGAAGAATTCAACTTCGTCGAAAGCGTCGACGGCCGTGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTACGCCCTGGGTACCCGTGTCACCGATGCCTTCTCGCGTTACGGCTGGTGCG
TGGCCATCCGCGGTGTAGAAGGTGGCGGCCTGGTAGAAGGCCTGCCAACCCACACCTTCAAGACCGATGA
CGGCGAAATTGCCCTCAAATGCCCAACTGAGATCGCCATCACCGACCGCCGTGAAAAAGAGCTGTCGGAC
CTTGGCTTCATCCCGCTGGTGCACTGCAAAGGCACCGACTACGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAGCAGAAGCAGTACAACACCGACATCGCCAATGCCAACGCACGCCTGTCGGCGCAGCTGCAGTACAT
CTTCGCCACCTCGCGCATTGCCCACTACATGAAGGCGATCATGCGCGACAAGATTGGCAGCTTCGCCTCG
CGCATGGACGTCGAGCGTTTCCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTTGACGACACTGCCAGCC
AGGAAGCCAAAGCCAAGTTCCCGCTGCGCGAAGCCCGTGCCGAAGTGTTCGAGGTACCAGGCAAGCCAGG
TGTGTACAAGGCCGTGACCTACCTGCGGCCGCACTACCAGCTCGACGAACTGACCGCTTCGCTGCGCCTG
GTCGCAGAGCTGCCGCAAGGCGCTCGCGGCTGA