SecReT6
Protein ID: 170721691
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2510
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2791599..2792132 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1J8F9
KEGG IDppw:PputW619_2510
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-61, Aligned region: 11..165
Protein Sequence: 177 a.a.     [Download]
>gi|170721691|ref|YP_001749379.1| type VI secretion protein [Pseudomonas putida W619]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVFIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSMEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAAVPAADGKE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2792132-2791599 Pseudomonas putida W619 chromosome, complete genome
ATGGCGAAGAAGGAAAGTACCCAGCACAAACTCGACCGCGTTCGCGCGCCGCGGGTTCACATCACTTACG
ACGTGGACATCGGTGATGCGATCGAGAAAAAGGAGCTGCCCTTTGTCGTTGGCGTGCTGGGCGATTTTTC
CGGCAACCCGCTGGAGCCCTTGCCCAAGCTCAAGGACCGCAAGTTCGTCTTCATCGACCGCGACAACTTC
AACGGCGTGCTCAAAGGCATCAAGCCGCGCCTGACCTACCGCGTCGACAACACCCTGGCCAAAAACGGCA
CCCAGCTGGGCGTGGAGCTGAACTTCAACAGCATGGAAGACTTCGAGCCACAGAACGTGGTGAAGCAAGT
CGAGCCACTGCGCAAGCTTTTGGAAGTGCGCAACAAGCTGGCCGACCTGCGTAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGTTGCTGATGGACGTGCTGCAGAACACCGAGAAGCTGAAAACCCTGGGCAAGGAAT
TCGGTCGCGAAGCCGCCGTACCCGCCGCCGATGGCAAAGAGTAA