SecReT6
Protein ID: 170721698
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2517
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2798673..2800523 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1J8W7
KEGG IDppw:PputW619_2517
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-85, Aligned region: 37..346
Phage_base_V [PF04717], Evalue: 6.20E-24, Aligned region: 380..473
Gp5_C [PF06715], Evalue: 4.20E-06, Aligned region: 524..545
Gp5_C [PF06715], Evalue: 4.20E-06, Aligned region: 556..563
DUF2345 [PF10106], Evalue: 0.0043, Aligned region: 564..596
Protein Sequence: 616 a.a.     [Download]
>gi|170721698|ref|YP_001749386.1| ImpA family type VI secretion-associated protein [Pseudomonas putida W619]
MITDALESMLTQNKRLFTFDSPLPPEQELQLLSFSGREAISELFSFQAELISQDARIELKKLIGKKVTVG
IALADGSTRYLSAHVSDFVHTGADGGVANYSAELVPWIWILSRRRDSRIFQDKTTEQIVKEVFDYYLTLA
DHEFRLSQPLKPISYCTQYQESDLNFVLRMLEQEGLFFTFEHSKEGHRMIISDDSSILPQLERQPLIRYH
SASVTETADSITAWSSARRMQPTRLALKSFDYKQPANPHLVQLNSVNQQGEVGQYEVFEYEGLYGYADSD
EGLRKARRRLEAIEVDGKTFHGKSNCRAMEPGRYFELSQHYDHDNDTPDDRQFLLLSVTHWGRNNYANDG
EAGYGNSFTCIRRKIPFRPSLSTPRAGISGPQTAIVVGPPGEEIYTDELGRVKLQFHWDRNGEFNDQSSC
WVRVAQSGASGGFGSILIPRVGDEVVVVFLDGNPDRPLIMGSLYNSSNTPPWSLPANKTQSGFLTRSMKG
DGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRTITVGGAHTEIIKKDTVVNVQEGGYTL
QVDNKFVQVSAKERILLQVGGSKIAITPEGITIEADKIDILGKNTFVKGDRVDINE
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|170719187|ref|NC_010501.1|:2798673-2800523 Pseudomonas putida W619 chromosome, complete genome
ATGATTACGGACGCCCTCGAGTCGATGCTCACGCAGAATAAACGCCTGTTCACTTTCGACTCACCTTTGC
CTCCCGAACAAGAGCTTCAACTGCTTAGCTTCAGCGGCCGCGAGGCGATTTCGGAACTGTTCAGCTTCCA
GGCAGAACTCATCTCCCAGGATGCTCGGATCGAGCTCAAGAAACTCATTGGCAAGAAGGTAACTGTAGGC
ATCGCGCTGGCCGATGGGAGCACCAGATACCTCAGTGCGCATGTTTCTGACTTCGTGCATACCGGTGCCG
ATGGGGGCGTTGCTAACTACAGCGCAGAGCTCGTGCCGTGGATCTGGATCCTCAGCCGTCGCCGTGATTC
GCGCATCTTCCAAGACAAGACCACCGAGCAGATCGTCAAGGAAGTCTTCGATTACTACCTGACCTTGGCC
GACCACGAATTCCGCCTGAGCCAACCGCTCAAACCGATCAGCTACTGTACGCAGTATCAGGAATCTGACC
TGAATTTCGTGCTGCGTATGCTTGAGCAGGAAGGGCTGTTCTTCACCTTCGAGCATTCTAAGGAAGGTCA
TCGCATGATTATCAGCGATGACAGCAGCATTCTTCCGCAGCTGGAGCGTCAGCCACTGATCCGTTACCAC
AGTGCTTCGGTCACCGAAACTGCAGATTCGATCACCGCCTGGTCTTCGGCGCGGCGGATGCAGCCAACGC
GCTTGGCTCTAAAGTCGTTCGACTACAAGCAGCCTGCCAACCCGCATTTGGTACAGCTCAATTCCGTCAA
CCAGCAGGGCGAGGTCGGCCAGTACGAAGTCTTCGAATACGAAGGCCTTTACGGTTACGCCGATTCAGAT
GAGGGCCTGCGCAAGGCTCGGCGTCGGCTGGAGGCAATAGAGGTGGACGGCAAGACATTCCATGGCAAGA
GCAATTGCCGCGCCATGGAGCCGGGTCGTTACTTCGAGCTTAGCCAGCATTACGATCACGACAACGACAC
TCCGGACGATCGCCAGTTTCTTCTGCTGTCCGTCACTCACTGGGGGCGTAACAATTACGCCAATGACGGT
GAAGCAGGGTATGGGAACAGCTTTACCTGTATCCGTCGCAAAATTCCGTTCCGCCCCTCATTGAGCACGC
CTAGGGCAGGCATCTCCGGGCCCCAAACAGCCATTGTCGTCGGCCCGCCGGGCGAAGAGATCTACACCGA
CGAACTGGGCCGAGTGAAATTGCAGTTCCACTGGGACCGCAACGGCGAGTTCAACGACCAGAGTTCCTGC
TGGGTACGCGTCGCCCAGTCCGGTGCCAGCGGCGGCTTCGGCAGCATTTTGATCCCCCGCGTCGGCGACG
AAGTGGTGGTGGTGTTCCTCGACGGCAACCCCGACCGCCCGCTGATCATGGGCAGCCTGTACAACAGCAG
CAACACCCCGCCCTGGTCGTTGCCGGCGAACAAGACCCAGAGTGGCTTCCTGACCCGCTCGATGAAAGGC
GACGGCGGTACCGCGAACTTCTTCCGCTTCGAAGACAAGGCCGGCGCCGAGCAGATCATCATGCACGCCG
AGCGCAACATGGACACCGAGATCGAGCTGGATGAGACCCATGATGTGGGGAACAACCGGACGATCACGGT
GGGGGGCGCGCACACCGAGATCATCAAGAAAGATACGGTAGTGAATGTTCAGGAAGGTGGCTACACCCTG
CAGGTGGATAACAAGTTCGTTCAGGTGAGCGCCAAAGAACGCATATTGCTTCAGGTCGGGGGCAGCAAGA
TCGCGATTACACCCGAAGGCATCACCATCGAAGCCGACAAGATCGACATCCTTGGTAAAAACACCTTCGT
CAAAGGTGACCGTGTCGATATCAACGAGTAA