SecReT6
Protein ID: 170722410
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3241
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3573595..3574746 [-]
ProductOmpA/MotB domain-containing protein
NoteTssA
UniProt IDB1JAL7
KEGG IDppw:PputW619_3241
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 263..359
ImpA-rel_N [PF06812], Evalue: 2.20E-13, Aligned region: 40..99
Protein Sequence: 383 a.a.     [Download]
>gi|170722410|ref|YP_001750098.1| OmpA/MotB domain-containing protein [Pseudomonas putida W619]
MTALFEMRVRLGGDPGNFDEFKVLHGELAKLTHPACPDVDWAKVEGLSLRLFELNGIELQTAVAFVLARS
YRTGVTGLTEGVALLATLSDEWPRLWPVQASARIDLIAWLFTQLHPLVRMVAWGRSSSAGLSELIVELNR
LEHRLERLGHAPLVALQVFRNQLVSLLQRMPGGRVAAMPLPLQSWATIAEPSITPQMAAAVSAPSTYTFV
VEPPAQKRVVLPWLLLLMVTIACLGWLGWQEWSSRQAKEPPTSDPIQLDSLNLFDPGSDELKPGSTKLLV
NALVGIKAQPGWLIVISGHADARGDAAKNLDLSRARASAVRDWMQRMGDIPDSCFAVQGVAASQPVSSND
TVNGRAENRRVDIRLVPQGDACGELEVVGHSFR
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3574746-3573595 Pseudomonas putida W619 chromosome, complete genome
ATGACGGCACTTTTTGAGATGCGTGTTCGCCTGGGTGGGGATCCAGGCAACTTCGATGAGTTCAAGGTGT
TGCACGGTGAGCTGGCCAAGCTCACGCACCCCGCCTGTCCCGATGTGGACTGGGCAAAAGTTGAGGGGTT
GTCTTTGCGACTCTTCGAGCTGAACGGGATTGAACTGCAGACGGCGGTGGCGTTCGTACTGGCGCGTAGC
TACCGCACGGGTGTGACGGGCTTGACCGAGGGTGTGGCGCTGCTCGCTACACTGAGCGATGAGTGGCCGC
GCTTATGGCCAGTGCAGGCGTCAGCTCGCATCGATCTCATTGCATGGCTGTTTACTCAGTTGCATCCCTT
GGTTCGCATGGTGGCGTGGGGCAGGTCGAGTTCGGCGGGGTTGAGCGAACTGATTGTCGAGTTGAACCGC
CTGGAGCACCGCTTGGAACGCCTTGGCCATGCACCTTTGGTTGCGCTGCAGGTCTTCCGAAACCAACTGG
TCAGCCTCCTGCAGCGTATGCCAGGAGGCCGGGTGGCGGCGATGCCGCTTCCTCTGCAATCCTGGGCGAC
GATTGCTGAGCCATCCATCACGCCTCAAATGGCTGCTGCCGTTTCTGCCCCTTCGACCTACACATTTGTA
GTCGAGCCTCCGGCGCAGAAGCGTGTCGTGTTGCCGTGGTTACTGCTGCTGATGGTCACTATTGCATGCT
TGGGGTGGTTAGGTTGGCAAGAGTGGTCATCCAGGCAAGCCAAAGAACCCCCTACGTCCGATCCAATCCA
ACTCGACAGTTTGAACCTGTTCGATCCTGGCAGTGACGAACTCAAGCCGGGTTCAACCAAGCTGCTGGTC
AATGCACTGGTTGGAATCAAGGCCCAGCCTGGCTGGTTGATCGTTATCTCCGGGCATGCGGATGCGCGGG
GCGATGCAGCCAAGAATCTCGATCTTTCTCGTGCCCGCGCCTCCGCTGTTCGCGACTGGATGCAGCGTAT
GGGCGATATCCCGGACAGTTGCTTTGCTGTCCAAGGTGTCGCGGCCAGTCAACCGGTCAGCAGCAACGAC
ACCGTGAATGGTCGCGCAGAAAATCGTCGGGTGGACATTCGATTGGTACCTCAGGGAGATGCATGTGGCG
AGCTGGAGGTCGTAGGGCATTCGTTTCGGTGA