SecReT6
Protein ID: 170722411
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3242
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3574758..3575204 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1JAL8
KEGG IDppw:PputW619_3242
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-18, Aligned region: 28..115
PapC_C [PF13953], Evalue: 0.0089, Aligned region: 25..34
PapC_C [PF13953], Evalue: 0.0089, Aligned region: 124..148
Protein Sequence: 148 a.a.     [Download]
>gi|170722411|ref|YP_001750099.1| type VI secretion system lysozyme-like protein [Pseudomonas putida W619]
MPETSPSLYEILLQNFRSELALDQVNEDDQLTLSVLDNIQRILNSRAGSLSHLPDYGLPDMGTVLQGLPA
SAHGLMNDIARTLRRYEPRLAQVSVQLIPQSRPGHLDYALDVVIKGGGRASFGTTVGAEGRVVVRHLKQE
GYLPVQWN
 
Nucleotide Sequence: 447 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3575204-3574758 Pseudomonas putida W619 chromosome, complete genome
ATGCCTGAAACCAGTCCTTCTCTTTACGAAATCCTGTTGCAGAACTTCCGCAGTGAGCTAGCGCTGGACC
AGGTGAATGAAGATGACCAGCTGACACTCTCGGTGCTGGACAACATTCAGCGCATTCTCAACAGCCGTGC
AGGTTCACTCTCGCATCTGCCCGACTATGGCTTGCCGGACATGGGCACAGTGCTGCAAGGGCTACCGGCT
TCAGCACATGGCTTGATGAACGACATCGCCCGCACCTTGCGCCGCTATGAGCCCCGGCTGGCGCAGGTGA
GCGTTCAGCTGATACCTCAGTCTCGCCCTGGCCATCTTGACTATGCCCTTGACGTGGTCATCAAGGGCGG
CGGCAGGGCGTCCTTTGGGACCACAGTCGGCGCCGAAGGCAGGGTTGTGGTGCGTCACCTCAAGCAGGAA
GGCTACCTTCCCGTGCAATGGAACTGA