SecReT6
Protein ID: 170722413
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3244
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3575726..3576823 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1JAM0
KEGG IDppw:PputW619_3244
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-82, Aligned region: 23..325
Protein Sequence: 365 a.a.     [Download]
>gi|170722413|ref|YP_001750101.1| type VI secretion protein [Pseudomonas putida W619]
MERTSQSAYSRLKAEGILHVLAEQVSTANVYRFCQVLEQVLAEQPPLGSTAHPSDDRVRFRPDPGMGFPA
GELKAIEIDESAPHRPLTVRTRLLGLYGVDSPLPTGYLDDIAQRREGHEALEHFLDIFNHRLFTQFYRIW
RKYSYPATFEPGGRDATSQCLLGLIGLGIPGTAERIATPMSRFLALLSVMRLPTRNAEGIGALVKLLAPH
TDTHVTGHWPQSVVLEQPASLAPAHPVTLGQGMPLGAVGHDANSQLRLRLCTDDQNEAREWLPGGRLIAD
LRVLLEVYLGWRCTALLQLSIPREMVPAPVLGRTRSMLGMTAVLKRAEGVLASAQDDTITINLGRYQGLQ
PNPCRKEVQHVAYRF
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3576823-3575726 Pseudomonas putida W619 chromosome, complete genome
ATGGAGCGAACATCACAGTCAGCGTATTCCCGGTTGAAGGCCGAGGGCATTCTGCATGTGTTGGCTGAAC
AGGTATCGACGGCTAACGTCTACCGCTTCTGCCAAGTGCTGGAACAGGTTCTGGCTGAACAACCACCGCT
GGGCAGCACTGCACATCCCAGTGATGACCGGGTCAGGTTCCGGCCAGACCCTGGAATGGGATTTCCAGCA
GGCGAGTTGAAGGCCATTGAAATCGACGAGTCTGCTCCACACCGACCGCTGACAGTGCGAACCCGGCTGC
TGGGTTTGTATGGCGTCGACTCTCCATTGCCCACGGGCTATCTGGATGATATCGCCCAGCGACGCGAAGG
CCATGAGGCGCTGGAGCACTTCCTCGATATCTTCAACCATCGGCTATTTACCCAGTTCTACCGGATCTGG
CGCAAGTACTCCTACCCGGCAACGTTCGAGCCGGGCGGGCGTGATGCGACTTCACAGTGTTTGTTGGGTT
TGATCGGGCTGGGGATTCCCGGTACGGCAGAGCGTATCGCCACACCGATGTCACGTTTCCTGGCCCTGCT
CAGCGTGATGCGTCTACCCACGCGTAACGCGGAGGGGATTGGTGCGCTGGTGAAGTTGCTGGCGCCGCAC
ACGGATACGCACGTGACCGGGCATTGGCCGCAGAGCGTTGTGCTTGAGCAGCCCGCCAGCCTTGCGCCAG
CGCATCCGGTGACCTTGGGCCAAGGCATGCCATTGGGCGCTGTCGGGCACGACGCGAACAGCCAACTGCG
CCTGCGGCTGTGCACCGACGACCAGAATGAGGCGCGTGAGTGGCTTCCTGGTGGCCGGCTGATTGCCGAT
CTGCGCGTGTTGCTTGAAGTGTATCTGGGGTGGCGTTGTACAGCGCTGCTGCAGCTCTCAATTCCACGTG
AGATGGTGCCGGCTCCTGTACTAGGACGCACTCGGTCGATGCTTGGCATGACCGCTGTGTTGAAACGGGC
AGAGGGCGTACTCGCATCGGCTCAAGACGACACGATCACGATTAACCTGGGCCGATATCAAGGTCTGCAG
CCGAACCCTTGCAGGAAGGAGGTACAGCATGTGGCGTACCGTTTTTAA