SecReT6
Protein ID: 170722414
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3245
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3576787..3578556 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JAM1
KEGG IDppw:PputW619_3245
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.20E-182, Aligned region: 8..586
Protein Sequence: 589 a.a.     [Download]
>gi|170722414|ref|YP_001750102.1| type VI secretion protein [Pseudomonas putida W619]
MTTDNLTLRYFDAEMRYLREAGKEFAQAFPDRAAQLNLDKPGAEDPFVERLFEGFAFLMGRLREKLDDDL
PELTEGLVSLLWPHYLRTIPSLAIVELMPDVSQMKGCEAVARGFQVLSQPVGQHRTRCRYSTTQDLTLRP
LNLETVRLDHESDGRAVLRLRFARGALASWDQLDLAHIPLYLNGDAALASVLHQALTLNVQALHVRLPGE
AQRKAFAGQFKPKGFADDDRLWPKGDSAFSGYQLLLEYFTFREKFMFVTLCGLESLVLPADAPWFELEVV
LSETWSHTFTPTQEHIRLHAVPVINLFALEADPLILDPLQNEYLLRPMRLQDGHTEIYSVDKVSGAKDSV
RQDYVPFSSFRHKGGMLRDEAPERYFHTRLRRGANGLHDTWLILGGEGFDKDVLLNRKSLSLRLTGTNGQ
LPRKALRSTLLDAAAQSTQAGLRVRNLTAPTLPCYPPNRDRFHWRVLSHLGSNFLPMLNSAEVLRGTLAL
YEWTGSETNRRRLEAIVDVKHHLIQRFEKGFLLRGVDIEVTVDSNGFSGEGDICLFGEMLSRFFALYADI
HLCTQLTMILQPTGRCLRWSEHHSQRIPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3578556-3576787 Pseudomonas putida W619 chromosome, complete genome
TTGACTACGGACAACCTAACCCTGCGTTACTTCGACGCTGAAATGCGCTACCTGCGGGAAGCGGGCAAGG
AGTTTGCCCAAGCTTTCCCGGATCGGGCGGCGCAGCTCAACCTGGATAAGCCCGGCGCTGAAGACCCCTT
TGTTGAGCGTTTGTTCGAAGGCTTTGCGTTCCTGATGGGGCGTCTGCGTGAGAAATTGGACGATGACTTG
CCAGAACTGACCGAGGGGCTGGTGAGTCTCCTGTGGCCCCACTACTTGCGCACCATCCCGTCACTGGCCA
TCGTCGAACTGATGCCAGATGTCAGTCAGATGAAAGGCTGCGAGGCGGTCGCAAGAGGCTTTCAGGTGCT
ATCACAACCGGTGGGTCAGCACCGTACCCGCTGCCGCTACTCCACCACGCAGGATTTGACGCTACGACCG
CTCAATCTGGAAACCGTGCGACTTGACCATGAGTCAGATGGGCGTGCAGTTCTACGCCTACGCTTCGCGC
GTGGAGCACTGGCCAGCTGGGATCAACTCGACCTCGCGCATATCCCCTTGTATCTGAATGGCGACGCGGC
GCTTGCCAGTGTGCTGCACCAGGCGCTGACATTGAATGTGCAGGCGCTGCATGTGCGCTTGCCAGGCGAG
GCGCAGCGCAAGGCATTTGCGGGGCAATTCAAGCCAAAGGGGTTTGCGGACGATGATCGCCTTTGGCCAA
AAGGCGACAGCGCCTTCAGCGGTTATCAGTTGTTGCTGGAGTACTTTACGTTCCGCGAGAAGTTCATGTT
CGTGACGCTCTGCGGCCTGGAATCGCTCGTGCTGCCTGCGGACGCGCCCTGGTTCGAACTTGAAGTAGTA
CTCAGTGAGACGTGGTCGCATACGTTTACGCCGACGCAAGAGCACATTCGTTTGCACGCGGTCCCCGTGA
TCAACTTATTTGCACTGGAGGCTGATCCACTCATCTTGGACCCGTTGCAGAATGAATACTTGCTTCGCCC
GATGCGCTTGCAGGACGGTCATACAGAGATCTACTCGGTAGACAAGGTTTCTGGAGCGAAAGACAGCGTT
CGTCAGGATTACGTGCCGTTCAGCAGCTTTCGTCACAAAGGGGGGATGCTTCGCGATGAGGCCCCCGAGC
GCTATTTTCATACCCGCCTGAGACGCGGCGCCAATGGTCTTCATGATACTTGGCTGATTCTTGGCGGGGA
GGGCTTTGACAAGGATGTATTGCTCAATCGCAAAAGCCTGTCGTTGCGCCTGACCGGCACCAATGGCCAG
CTGCCGCGCAAAGCCTTGCGCAGCACCTTGCTCGATGCTGCGGCGCAGTCCACCCAGGCAGGTTTGCGAG
TGCGCAACCTGACCGCGCCGACATTACCGTGCTACCCACCCAATCGCGACCGTTTTCACTGGCGAGTACT
CAGTCACCTGGGGTCGAATTTTCTACCGATGCTCAACAGTGCAGAAGTACTGCGTGGCACGTTGGCCTTG
TACGAGTGGACGGGTAGCGAAACCAACCGCCGCCGTCTGGAGGCCATTGTCGACGTCAAGCATCACCTGA
TCCAGCGCTTCGAAAAAGGCTTCTTGCTGCGAGGTGTGGATATCGAAGTGACGGTCGATAGCAATGGCTT
TTCAGGCGAGGGGGATATCTGCCTGTTTGGTGAAATGCTCAGCCGGTTCTTCGCTCTGTATGCGGACATT
CATTTGTGCACTCAACTGACGATGATTTTGCAGCCGACGGGGAGGTGCCTGCGATGGAGCGAACATCACA
GTCAGCGTATTCCCGGTTGA