SecReT6
Protein ID: 170722415
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3246
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3578580..3580166 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDB1JAM2
KEGG IDppw:PputW619_3246
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 64..124
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 411..424
Protein Sequence: 528 a.a.     [Download]
>gi|170722415|ref|YP_001750103.1| type VI secretion-associated protein [Pseudomonas putida W619]
MSLKRLVESCLPTSEPLVIARKHGESWEPWLTPINGDVPVGEDPGYDDDFQRMREEVNKLSGADVDLVAQ
LAHKLLQQSCKDLRVATYYLWARLHRDGETGLADGLSLLAALMERYASDILPARPNSRKMALEWLAGSRV
QASLSLYPQVVKAETERTVAALVWLEHGFSHWPEDQRPRLDALYGALNSRLAASGGVDAIVPQTGSESPG
DGRAASPSPTPIKSGRDLLDSGRGLASYLRDQPEGWLAAHRLMKSLRWDTVHQVPPQTAQGITRLAPPRG
EYRAQLKRLHLQQSWSELIDQVEQMYAEGVNHFWLDLQWYLHQALSKSAEPYKSWADIVKHDLAMLLHRL
PGVELLCWSDGSPFADEATREWINQQVSGNRPEQWLPTAAPASSAAACEILVLEPEALAQADADGVEQAL
AWLASRPDVQTGRQRWLLRLLMARVAEQCGKAELAIHLFTELDAAAQRHTFADWEPDLLFEVKARLLKLL
RLKAQRNDADRPALARQMEHQLAALVSIDPVRAAVLCS
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3580166-3578580 Pseudomonas putida W619 chromosome, complete genome
ATGAGCCTGAAAAGACTGGTAGAGAGCTGTTTGCCCACCAGCGAGCCGCTGGTCATTGCCCGCAAACACG
GCGAATCCTGGGAGCCTTGGCTAACGCCTATCAACGGCGATGTACCGGTGGGAGAGGACCCGGGCTACGA
CGACGACTTCCAGCGCATGCGCGAAGAGGTCAACAAACTCTCCGGGGCGGATGTGGACCTTGTTGCGCAA
CTGGCGCATAAGCTACTCCAGCAGTCCTGCAAAGACCTTCGTGTTGCCACCTACTACCTCTGGGCACGTT
TGCACAGGGACGGTGAGACCGGCTTGGCAGATGGCCTGAGTTTGCTGGCGGCGCTGATGGAACGCTATGC
CTCCGACATCCTGCCGGCGCGTCCCAATAGCCGCAAGATGGCCTTGGAGTGGCTTGCCGGCAGCAGGGTC
CAGGCAAGCCTGTCGCTGTACCCTCAAGTGGTCAAGGCTGAAACCGAGCGAACGGTGGCTGCTTTGGTGT
GGTTGGAGCACGGCTTCAGCCATTGGCCAGAAGACCAGCGGCCACGACTGGACGCCTTGTACGGCGCCCT
CAACAGTCGACTCGCCGCGTCGGGAGGTGTTGATGCAATCGTCCCCCAGACTGGCAGTGAGTCACCTGGA
GACGGTAGGGCGGCAAGCCCGAGCCCGACCCCCATAAAGTCGGGCCGAGATTTGCTGGACAGTGGTAGAG
GGCTAGCCAGCTATCTACGTGATCAACCAGAAGGGTGGTTGGCGGCGCATCGGCTGATGAAGAGTTTGCG
CTGGGACACCGTGCATCAGGTGCCGCCGCAAACTGCCCAGGGGATTACCCGCCTGGCGCCGCCTCGCGGC
GAGTATCGCGCTCAGCTCAAGCGCTTGCACCTGCAGCAAAGCTGGAGCGAGTTGATTGATCAGGTCGAGC
AAATGTATGCCGAAGGCGTCAACCACTTCTGGTTGGATCTGCAATGGTATCTCCATCAGGCCTTGAGCAA
ATCCGCTGAGCCCTACAAAAGCTGGGCGGATATCGTCAAACACGATCTGGCCATGCTGCTGCACCGTCTG
CCGGGCGTGGAGCTGCTGTGTTGGAGCGATGGCTCGCCATTCGCCGATGAAGCCACGCGTGAGTGGATCA
ACCAGCAGGTCAGCGGTAACCGCCCAGAACAATGGCTGCCCACAGCGGCCCCCGCATCGTCGGCGGCTGC
ATGCGAAATACTCGTCTTGGAACCCGAGGCACTGGCGCAAGCGGATGCTGATGGCGTGGAGCAGGCACTG
GCGTGGCTGGCGAGCCGTCCAGATGTGCAGACCGGGCGGCAACGTTGGTTACTGCGTTTGTTGATGGCGC
GAGTGGCCGAACAGTGCGGCAAGGCAGAGCTGGCCATTCATTTGTTCACTGAGCTCGACGCTGCCGCGCA
ACGCCACACATTTGCCGACTGGGAGCCCGACCTGCTCTTCGAGGTCAAGGCGCGTTTACTCAAGCTGCTG
CGTTTGAAAGCCCAGCGCAACGATGCTGACCGGCCTGCGTTGGCGCGGCAAATGGAACATCAGTTGGCAG
CACTTGTATCCATTGACCCGGTACGTGCTGCAGTCCTGTGCAGCTAA