SecReT6
Protein ID: 170722423
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3254
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3592074..3594437 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1JAN0
KEGG IDppw:PputW619_3254
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-61, Aligned region: 33..354
Phage_GPD [PF05954], Evalue: 1.80E-61, Aligned region: 470..512
DUF2345 [PF10106], Evalue: 2.20E-43, Aligned region: 611..754
T6SS_Vgr [PF13296], Evalue: 1.20E-33, Aligned region: 488..593
T6SS_Vgr [PF13296], Evalue: 1.20E-33, Aligned region: 628..651
Phage_base_V [PF04717], Evalue: 5.20E-19, Aligned region: 210..238
Phage_base_V [PF04717], Evalue: 5.20E-19, Aligned region: 387..482
Protein Sequence: 787 a.a.     [Download]
>gi|170722423|ref|YP_001750111.1| ImpA family type VI secretion-associated protein [Pseudomonas putida W619]
MTKPIMGFTHNHYQLEVDQLAVELDVLSFKGEEWLSKPFKYTVVFTSPEQDIEAAQILGKDASFYLGKSQ
PTVQLSMINAASRTLHGVITGFKRVSGSRDEARYQVTLEAHLALLGRGKQYRIYQHQSVPEIVESVLRSR
HQFEGQHFLFDLAREYPKREQVMQYGESDLAFISRLLAEVGIWYRFTHDDRLSLDVVEFHDHQRHYQFGL
TLPHRPLSGLTSNGQEGVWALQVEHQVVEQHINVRAYHHRDAAAFLDGEVDHSRGATTTYGEGYHYGEPY
TALGDAIDQDEDLLSESGYFYARLNHERFLNDQTRCNGVSSSVTLAPGQVLTVSDGAPQVFEPGVVITHL
TVEAARDRSLEAKFDAIPYSEAIGFRPKLLGKPQIAGTVPARVTSTQKNDPYGHIDMEGRYRVNFLFDRD
TWRAGEESVWLRLARPYAGDTHGLHLPLICGTEVAVAFEQGDPDRPYIAYALHDSEHPDHVTLRNYKRNV
LRTPANNKFRLDDTRGQEHIKLSTEHSGKSQLNLGHVVDAERKPRGAGAELRTDGHVAMRGGSGIFISAD
TQPGAKGHMLEMAAVLERLDQAKEQLEGLSDDAQACKAEPADVQAQLDLLKQDLEQLKSSVLILSAPQGI
SLTSGGHLQLAAQKNLMLNAGGEADVSVVKRLFVGIGQGLSVFVRKLGIKLIANQGPVSIQAQNDALSLI
ARHGLEICSTEDEIRITAKKKITLNAGGSYIAIDACSIESGTEGDCLIKAASFEYLEEPAKKMIDVPSMP
PLANHDPESLNTTVFSG
 
Nucleotide Sequence: 2364 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3594437-3592074 Pseudomonas putida W619 chromosome, complete genome
ATGACGAAGCCAATAATGGGTTTCACCCATAACCACTACCAGCTTGAAGTCGACCAGCTTGCTGTTGAGC
TTGATGTACTGTCGTTCAAAGGTGAAGAGTGGCTGAGCAAACCGTTCAAGTACACCGTGGTATTCACTTC
CCCGGAGCAGGATATCGAGGCTGCGCAGATCCTCGGGAAGGATGCCAGCTTCTATCTGGGCAAGTCTCAA
CCCACCGTCCAGCTCTCAATGATTAACGCTGCTTCACGTACGCTGCATGGCGTGATCACCGGTTTCAAGC
GTGTCTCCGGCTCCCGGGATGAAGCCCGCTACCAAGTCACACTCGAAGCGCACCTGGCATTGCTCGGGCG
TGGCAAGCAGTACCGGATCTACCAGCATCAGTCGGTGCCGGAAATCGTTGAAAGTGTTCTCCGTAGTCGC
CACCAGTTCGAAGGGCAGCACTTCTTGTTTGACCTGGCGCGCGAGTATCCCAAGCGTGAACAGGTCATGC
AGTACGGTGAGAGCGATCTGGCCTTCATCAGCCGCCTGCTGGCGGAGGTCGGCATCTGGTATCGCTTCAC
CCACGATGATCGCCTTTCCCTCGATGTGGTCGAGTTTCACGACCATCAACGCCACTACCAGTTTGGACTC
ACGCTGCCGCATCGCCCGCTGTCGGGTTTGACCAGCAATGGGCAGGAGGGCGTATGGGCGCTCCAAGTTG
AGCATCAGGTGGTGGAGCAGCACATCAATGTGCGGGCTTATCACCACCGGGACGCGGCCGCCTTCCTGGA
TGGTGAGGTTGATCACAGCCGAGGTGCCACCACCACCTATGGCGAAGGCTATCACTACGGCGAACCCTAT
ACCGCGCTGGGTGACGCCATTGACCAGGATGAGGACCTGCTCAGCGAAAGTGGCTATTTCTATGCGCGCC
TGAATCATGAACGCTTTCTCAACGACCAGACGCGTTGCAATGGCGTTAGCAGCAGCGTGACGCTTGCCCC
AGGGCAAGTGCTGACGGTCTCTGACGGGGCGCCACAGGTGTTCGAGCCTGGGGTGGTCATTACACATTTG
ACCGTCGAGGCAGCACGCGACCGGAGCTTGGAGGCCAAGTTCGACGCGATTCCCTACTCGGAGGCGATAG
GCTTTCGGCCAAAATTGCTGGGCAAGCCACAGATTGCCGGTACGGTGCCGGCGCGGGTCACCAGTACGCA
AAAGAACGATCCTTATGGCCATATCGATATGGAGGGCCGCTACCGGGTCAATTTCCTGTTTGACCGGGAC
ACCTGGCGTGCAGGCGAGGAGAGTGTCTGGCTACGACTGGCACGGCCTTACGCGGGTGACACCCATGGCC
TGCACTTGCCGTTGATCTGCGGTACCGAAGTGGCGGTGGCGTTTGAGCAAGGCGATCCGGACCGCCCCTA
CATCGCTTATGCCTTGCACGACAGTGAACATCCCGACCACGTGACGCTGCGCAACTACAAACGCAATGTG
CTGCGGACTCCGGCCAACAACAAGTTCCGGCTGGACGATACGCGTGGACAGGAGCACATCAAGCTCAGTA
CCGAGCACAGCGGCAAGAGCCAGCTCAATCTGGGGCATGTGGTTGACGCTGAGCGCAAACCCCGAGGGGC
GGGGGCAGAACTACGCACCGATGGGCATGTCGCCATGCGCGGTGGCAGCGGCATCTTCATCAGTGCTGAT
ACGCAGCCAGGGGCCAAGGGGCACATGCTCGAAATGGCTGCTGTCCTGGAGCGCCTGGATCAGGCCAAAG
AGCAGTTGGAAGGGCTTTCGGATGACGCTCAGGCGTGCAAGGCGGAGCCTGCGGATGTCCAGGCCCAGCT
GGACCTGCTTAAGCAAGATCTGGAACAGCTCAAATCCTCGGTCCTGATACTGAGCGCCCCTCAGGGGATC
TCGCTAACCAGTGGCGGCCATCTTCAGCTGGCAGCGCAAAAGAACCTGATGCTCAACGCCGGTGGTGAGG
CCGATGTCAGCGTGGTCAAGCGGTTGTTTGTTGGGATAGGACAGGGGCTGAGTGTGTTTGTGCGCAAATT
GGGCATCAAGCTCATTGCCAACCAAGGGCCAGTCAGTATCCAGGCGCAGAACGACGCATTGTCGCTAATT
GCACGGCATGGTCTGGAAATTTGTAGTACTGAAGATGAGATCCGGATCACGGCGAAGAAGAAGATTACAC
TCAATGCGGGTGGGAGTTATATCGCGATAGATGCGTGCAGTATTGAGTCTGGGACGGAAGGCGATTGCCT
AATCAAGGCTGCAAGCTTCGAATATTTAGAAGAGCCTGCAAAGAAGATGATAGATGTTCCGTCCATGCCT
CCTTTGGCGAATCATGATCCAGAATCGCTAAATACCACTGTATTTTCAGGTTAG