SecReT6
Protein ID: 170722424
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3255
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3594440..3597094 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1JAN2
KEGG IDppw:PputW619_3255
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.80E-40, Aligned region: 29..48
AAA_2 [PF07724], Evalue: 5.80E-40, Aligned region: 229..248
AAA_2 [PF07724], Evalue: 5.80E-40, Aligned region: 605..768
AAA [PF00004], Evalue: 7.50E-19, Aligned region: 231..343
AAA [PF00004], Evalue: 7.50E-19, Aligned region: 609..731
ClpB_D2-small [PF10431], Evalue: 2.30E-15, Aligned region: 469..504
ClpB_D2-small [PF10431], Evalue: 2.30E-15, Aligned region: 775..848
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 208..252
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 276..309
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 488..488
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 577..652
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 673..703
AAA_16 [PF13191], Evalue: 4.80E-14, Aligned region: 747..800
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 306..361
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 608..726
AAA_22 [PF13401], Evalue: 1.50E-08, Aligned region: 230..316
AAA_22 [PF13401], Evalue: 1.50E-08, Aligned region: 608..629
AAA_22 [PF13401], Evalue: 1.50E-08, Aligned region: 670..702
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 231..306
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 285..319
AAA_25 [PF13481], Evalue: 1.20E-07, Aligned region: 606..640
Clp_N [PF02861], Evalue: 1.60E-07, Aligned region: 23..66
Clp_N [PF02861], Evalue: 1.60E-07, Aligned region: 105..124
NACHT [PF05729], Evalue: 1.30E-06, Aligned region: 231..327
NACHT [PF05729], Evalue: 1.30E-06, Aligned region: 608..632
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 21..75
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 231..296
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 514..540
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 607..644
AAA_17 [PF13207], Evalue: 4.50E-06, Aligned region: 791..813
Sigma54_activat [PF00158], Evalue: 6.30E-06, Aligned region: 212..245
Sigma54_activat [PF00158], Evalue: 6.30E-06, Aligned region: 602..734
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 225..290
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 608..629
Arch_ATPase [PF01637], Evalue: 9.20E-06, Aligned region: 209..245
Arch_ATPase [PF01637], Evalue: 9.20E-06, Aligned region: 283..380
Arch_ATPase [PF01637], Evalue: 9.20E-06, Aligned region: 607..625
Arch_ATPase [PF01637], Evalue: 9.20E-06, Aligned region: 679..694
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 223..251
Zeta_toxin [PF06414], Evalue: 1.20E-05, Aligned region: 601..648
AAA_14 [PF13173], Evalue: 0.00089, Aligned region: 231..334
AAA_14 [PF13173], Evalue: 0.00089, Aligned region: 607..698
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 609..630
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 706..727
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 607..630
SRP54 [PF00448], Evalue: 0.003, Aligned region: 231..251
SRP54 [PF00448], Evalue: 0.003, Aligned region: 607..653
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 231..251
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 514..543
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 609..633
DUF258 [PF03193], Evalue: 0.0081, Aligned region: 224..248
DUF258 [PF03193], Evalue: 0.0081, Aligned region: 607..628
AAA_28 [PF13521], Evalue: 0.0094, Aligned region: 231..268
AAA_28 [PF13521], Evalue: 0.0094, Aligned region: 608..628
Protein Sequence: 884 a.a.     [Download]
>gi|170722424|ref|YP_001750112.1| type VI secretion ATPase [Pseudomonas putida W619]
MAHDPARLLRRLNSYCTQALTAAASLCQTRGHSHITVEHWLLKLFEQGEGDLVVIARRYEWDIDAIWQGL
LDHFNTLPRSVLGKPQLSSEVQQLITNAWLLASLDRDCGQLRSIHLLWALFEAPNLLKCSAAWPLLSIGP
TQSEQVKTLLEFDSEERQSEQNSLFKPEVPEEAKAVVGTGGDSALLAILDQFSHDVTAKAAAGQIDPVFG
RDDEIRQVIDVLSRRRKNNPILVGDPGVGKTALVEGLALRIASGDVPDSLKPVCIRTLDLGLLQAGAGVK
GEFEQRLKNVIEAVQRSETPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQY
FERDAALERRFQMIKVDEPDDANACVMLRGLKARYASYHGVHVQDAAVQAAVSLSRRFLTGRRLPDKAVD
LIDTACARVRMSLDCEPQALVQLKSQKMAFTAERVVLEEDAQLTGITDESRLAKITTQLVQLESQQAALE
LQYQQELDLTHQLLNARQGEQVDTTVCAQLQEHLSYVQGSRPLLSLDVCARSVAEVIADWTGVPLGSLLK
DEHASLLNLEDQLAERVVGQDPALVALAQRLRAARTGLTDDKASMVVFLLVGTSGIGKTETAHALAHSLF
GGEKSLITLNMSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRQRPYSVVLLDEVEKAHRDVLNLFYQV
FDRGFMRDGEGREIDFRNTVILMTSNLGSDLLQGSIERQPGIEEAALHEILRPVLREHFHAALLARFQTL
IFRPLGPDALKRIVAIKLDQVAKRLLRHYGLQCEVDDSLYEALVAACLLPDTGARNIDSLLNQQILPVLS
QQLLQRQALGQPTQAVTLGYCEDAGISLSFADEHHAAAVAAEGV
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3597094-3594440 Pseudomonas putida W619 chromosome, complete genome
ATGGCACACGATCCTGCACGTTTGCTTCGCCGGCTCAACTCATATTGTACCCAGGCACTCACGGCAGCGG
CATCTTTATGCCAGACACGTGGGCACAGTCATATCACTGTTGAACATTGGCTGTTGAAATTGTTTGAACA
AGGTGAGGGCGATCTCGTGGTCATCGCCCGCCGATATGAGTGGGATATAGATGCCATCTGGCAGGGACTG
CTTGACCACTTCAATACATTGCCGCGCAGCGTTCTCGGCAAACCTCAGTTGAGCAGTGAGGTGCAGCAGC
TGATCACCAATGCCTGGTTGTTGGCATCGTTGGATCGTGACTGTGGACAATTGCGGTCCATTCACTTGCT
GTGGGCGCTATTTGAAGCGCCAAACTTGCTTAAGTGTTCAGCCGCTTGGCCTCTGTTGAGCATCGGTCCT
ACGCAATCGGAGCAAGTGAAAACGCTGCTTGAATTCGATTCGGAAGAACGTCAATCAGAGCAGAATTCAT
TGTTTAAGCCAGAAGTGCCAGAAGAGGCTAAGGCTGTGGTCGGCACAGGAGGTGATTCGGCACTGCTCGC
TATCTTGGATCAGTTCAGCCATGACGTTACTGCAAAGGCTGCAGCAGGGCAGATTGACCCGGTGTTCGGC
CGTGACGATGAAATCCGCCAGGTGATCGATGTACTGAGCCGTCGGCGCAAGAACAACCCCATTCTGGTAG
GCGACCCGGGTGTCGGAAAAACCGCACTGGTCGAGGGGCTGGCTTTACGCATCGCCAGCGGCGATGTGCC
CGATAGCTTGAAACCCGTGTGTATCCGTACGCTGGACCTGGGGTTGCTCCAGGCGGGCGCAGGGGTCAAA
GGCGAGTTCGAGCAACGGCTGAAGAACGTAATTGAGGCCGTCCAGCGGTCAGAGACGCCGGTGCTGCTGT
TCATCGATGAAGCGCACACCTTGATCGGTGCTGGCAATCAGGCAGGGGGCGCAGATGCGGCGAATCTGCT
GAAACCGGCTCTGGCGCGTGGCGAGCTGCGCACCATCGCTGCCACCACTTGGAGTGAATACAAGCAGTAC
TTCGAGCGCGATGCGGCGTTAGAGCGTCGCTTCCAGATGATCAAGGTCGATGAGCCGGATGATGCCAATG
CTTGTGTGATGCTGCGAGGGCTCAAAGCGCGTTATGCCAGCTACCACGGCGTGCATGTTCAAGACGCTGC
GGTGCAGGCGGCGGTCAGCTTGTCTCGCCGCTTTTTGACCGGGCGCCGTTTACCGGACAAAGCTGTGGAT
CTGATTGATACCGCCTGCGCGCGTGTTCGCATGAGCTTGGACTGCGAACCTCAGGCCTTGGTCCAGCTGA
AGTCGCAGAAAATGGCCTTCACGGCAGAGAGGGTGGTGCTGGAAGAGGACGCGCAGCTTACCGGTATTAC
GGATGAATCTCGCTTGGCGAAGATCACTACCCAGCTGGTGCAGCTGGAGAGTCAGCAAGCCGCGTTGGAG
CTGCAGTACCAACAAGAACTCGACCTCACCCACCAGCTGCTCAATGCTCGCCAGGGCGAGCAGGTTGATA
CAACTGTCTGCGCTCAGCTGCAAGAACACCTCAGCTACGTGCAGGGGAGTCGGCCACTGCTGTCCCTCGA
TGTGTGCGCACGCAGTGTGGCTGAGGTGATCGCAGACTGGACGGGCGTGCCTCTCGGTAGTCTGCTGAAA
GACGAACACGCCAGCTTGTTGAACCTGGAAGATCAGTTGGCCGAGCGTGTTGTTGGCCAAGACCCGGCGC
TGGTTGCTCTTGCCCAACGGTTGCGCGCCGCCCGAACGGGCCTCACTGACGACAAGGCATCGATGGTTGT
CTTCCTGCTGGTCGGTACCAGTGGCATCGGCAAGACGGAGACGGCGCATGCACTGGCCCACAGTCTGTTC
GGTGGCGAGAAATCCTTGATCACCCTCAACATGTCGGAGTATCAAGAGGCGCACACCGTCAGCCAACTCA
AGGGTTCGCCGCCGGGTTATGTGGGTTACGGCCAGGGTGGCGTACTCACCGAAGCCGTTCGCCAGCGCCC
TTATAGCGTGGTGTTGCTGGACGAAGTCGAAAAGGCCCACCGTGATGTGCTCAACCTGTTCTATCAGGTG
TTCGACCGCGGCTTCATGCGTGATGGAGAAGGAAGGGAGATCGATTTTCGCAACACGGTCATCCTCATGA
CTTCGAACCTGGGAAGCGATCTGCTGCAAGGTAGTATCGAGCGGCAGCCAGGCATTGAGGAAGCGGCACT
GCATGAGATATTGCGTCCCGTGTTACGCGAGCACTTCCATGCTGCACTGTTGGCTCGTTTCCAGACATTG
ATCTTCCGCCCATTGGGGCCCGATGCACTCAAGCGCATTGTCGCCATCAAACTCGATCAAGTGGCCAAGC
GCTTGCTGCGTCATTACGGCCTGCAATGTGAGGTTGATGACTCGCTCTACGAAGCGCTGGTCGCCGCCTG
CCTTTTGCCCGATACCGGCGCTCGCAATATCGATAGCTTGCTCAATCAACAGATCCTGCCGGTGCTCAGC
CAGCAGTTGCTGCAGCGCCAAGCCCTCGGCCAGCCAACACAAGCCGTGACGCTCGGGTACTGCGAAGACG
CTGGTATCAGTTTGAGCTTTGCAGATGAACACCACGCAGCCGCGGTGGCTGCCGAGGGGGTTTGA