SecReT6
Protein ID: 170722427
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3258
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3599500..3600168 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1JAN5
KEGG IDppw:PputW619_3258
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-39, Aligned region: 11..210
DUF1045 [PF06299], Evalue: 0.0046, Aligned region: 22..74
Protein Sequence: 222 a.a.     [Download]
>gi|170722427|ref|YP_001750115.1| hypothetical protein PputW619_3258 [Pseudomonas putida W619]
MQKHSAAKVDIDALLQDTYLLVVELRHGTDAHSSPQLWSRCVADVEHVRAMLQQEGLDRRSVDLISHAQC
ALLDETVLARAEGSAHEDWAMETLQARFFSSHQAGESLYEDMRSALQEASVHPCVLIVFHRVLMLGFLGR
YREANHPERQQLLTAISAQVPPLDTSQSLVVQLGSGPRMPMWGWVRSPLLHIVMAAALLVGAWWGLDHAL
GEAVASLLPVQE
 
Nucleotide Sequence: 669 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3600168-3599500 Pseudomonas putida W619 chromosome, complete genome
ATGCAGAAGCACAGCGCAGCCAAGGTGGACATCGACGCGTTGCTGCAGGACACCTATCTGTTGGTTGTCG
AGTTGCGACACGGTACCGATGCGCACAGTAGTCCGCAGCTGTGGTCAAGGTGCGTGGCTGATGTCGAGCA
TGTACGAGCCATGCTTCAGCAGGAGGGTCTGGACCGCCGCAGCGTCGATCTGATCAGTCATGCGCAGTGT
GCGCTTCTGGACGAAACAGTACTTGCCCGCGCCGAAGGCAGTGCCCATGAGGATTGGGCGATGGAGACCT
TACAGGCAAGGTTTTTCAGCAGCCATCAGGCGGGGGAGTCGCTCTACGAAGATATGCGCTCTGCGCTGCA
GGAAGCCTCTGTGCACCCTTGCGTACTCATAGTATTTCATCGAGTCCTGATGCTTGGATTCCTGGGGCGC
TACCGAGAAGCAAACCACCCGGAGCGGCAGCAGTTGTTGACTGCCATCTCCGCGCAAGTGCCGCCTCTGG
ATACAAGTCAGTCGCTGGTCGTCCAGTTAGGCAGTGGCCCACGGATGCCGATGTGGGGTTGGGTGCGGTC
TCCTCTGCTTCACATCGTGATGGCAGCGGCTCTGTTGGTAGGTGCTTGGTGGGGGCTTGATCACGCGTTA
GGTGAGGCAGTGGCCTCGCTCTTGCCGGTGCAGGAATGA