SecReT6
Protein ID: 170722428
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3259
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3600177..3601532 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1JAN6
KEGG IDppw:PputW619_3259
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-135, Aligned region: 18..448
Protein Sequence: 451 a.a.     [Download]
>gi|170722428|ref|YP_001750116.1| type VI secretion protein [Pseudomonas putida W619]
MKIDRPLWASGVVLSAQQFQQQARFESWTNQSIASLGLVHPWGIRSVAFDADALRLGKLMATRLQLCLPD
GTLIDTDRLDRLPRALELSRVLPGDIQTATVVIALPLEQANGNNCLFEGGSAERPVRYHQVWRDTKDLYT
SEIQSISVLEHALSLRLADDDNADYLTCPVGRLLRDGKDGWAIDDTYIPPLLKFDAHAGLLLQLDNLLTQ
LSAKRERLMGMRRESNQRMADFAVADVTLFWLLNALNTYQPVLADLKAQPARHPEQVYQQLVKLAGGLLT
FSLDQHIEDIPAYQHADLEAVFPPLMRTLSTLLEASLPSRVLALILEARSANRWQVSLSDPRLLEPEGAD
FYLSVRCRLPAVQVQSQFPRLCKIGSPDDVDHLVNAALDGVPLKPLSHVPAAIPLRLENQYFALDLSHAK
GRAMLADGVCALYVPSVFQDVQLELFAVLRS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3601532-3600177 Pseudomonas putida W619 chromosome, complete genome
GTGAAAATCGACCGGCCTTTATGGGCGTCCGGAGTGGTGTTGTCTGCGCAGCAGTTTCAACAGCAGGCCC
GCTTTGAATCGTGGACCAACCAGAGTATTGCCTCACTGGGCTTGGTCCACCCTTGGGGCATCCGAAGTGT
GGCGTTTGATGCAGATGCGCTGAGGTTGGGTAAGCTGATGGCCACTCGGCTTCAGTTGTGCCTACCAGAC
GGTACTTTGATCGACACCGATCGGCTGGATCGACTACCCAGAGCCCTGGAACTCTCTCGGGTATTGCCCG
GAGATATCCAGACGGCAACGGTTGTGATCGCTTTGCCACTGGAACAGGCCAATGGTAACAACTGCCTGTT
TGAGGGTGGCAGCGCTGAGCGGCCCGTCAGATATCACCAGGTATGGCGTGATACCAAGGATCTCTACACC
AGTGAAATACAGTCAATCAGCGTGCTCGAACATGCGCTGAGCTTGCGTCTGGCTGATGACGATAATGCGG
ATTATCTGACCTGCCCGGTGGGTCGTTTGCTGCGTGATGGCAAGGATGGGTGGGCCATTGATGATACCTA
CATCCCGCCGTTGCTGAAGTTTGATGCTCATGCTGGGTTGTTGCTTCAACTCGACAACCTGCTCACCCAG
CTGTCCGCCAAGCGTGAGCGTTTGATGGGAATGCGCCGGGAGAGCAACCAGCGAATGGCGGATTTCGCTG
TTGCAGATGTCACGTTGTTCTGGTTGCTCAACGCACTGAACACCTATCAGCCGGTGTTGGCAGACCTAAA
AGCGCAGCCTGCTCGCCATCCGGAGCAGGTATATCAACAGTTGGTGAAGCTTGCAGGTGGCCTGCTGACC
TTCTCGTTAGACCAGCACATAGAGGACATACCCGCCTACCAGCACGCGGACCTTGAGGCGGTTTTCCCGC
CCTTGATGCGTACCCTATCCACATTGCTGGAGGCGAGCCTGCCGTCCCGCGTGCTGGCGCTGATCCTGGA
GGCGCGTAGCGCAAACCGCTGGCAGGTTTCTCTGAGCGATCCACGTCTGCTTGAGCCTGAAGGTGCTGAC
TTCTATTTGTCGGTCCGTTGCCGGCTGCCAGCCGTACAAGTTCAAAGCCAATTCCCAAGGCTGTGCAAGA
TCGGTTCCCCCGATGATGTGGACCATCTCGTCAATGCGGCACTCGATGGCGTTCCACTGAAACCTTTGAG
CCATGTGCCCGCCGCGATACCGCTGCGGCTGGAGAATCAGTACTTCGCGCTCGACCTCAGCCATGCCAAG
GGCCGCGCCATGCTGGCTGATGGGGTCTGTGCCCTCTATGTCCCGAGTGTGTTTCAGGATGTCCAGCTCG
AATTGTTCGCGGTGCTTCGCTCATGA