SecReT6
Protein ID: 170722429
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3260
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3601556..3603094 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1JAN7
KEGG IDppw:PputW619_3260
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.40E-167, Aligned region: 87..508
Protein Sequence: 512 a.a.     [Download]
>gi|170722429|ref|YP_001750117.1| EvpB family type VI secretion protein [Pseudomonas putida W619]
MSEDQSSAQSRGATVQVEENQSVYHALFERINLEPLEQMGGIEVFQSIDALSEATANERVTASVSVFLDR
LKQVSPKVERLDRALLDEHIASIDAQISSQLDAVMHHPDFQRVESIWRGAKSLIDQTDFRQNVRIELLDI
SKEHLAQDFEDAPEIAQSGLYLHTYTQEYDTPGGEPIAAAVSNYEFGRGAQDIALLRNVSKVAAASHMPF
LYSVGPAFFGKNTMEEVSAIKDIGNYMDRAEYIKWHGFRQTDDARYAGGITPRTLGRLPYGPDTNPVRSF
NYVERVKGPDHSKYLWVSSTFAFAANMVKSFIANGWCVQIRGPQSGGAVTDLPIHLYDMGTGSQVKIPSE
VMIPETREFEFANLGLIPLSYYKNRDYACFFSANSAHKPAIYDTAEATANSRINSRLPYVFLLSRIAHYL
KVIQRENIGTTKDRRLLELELNRWVSGLVTEMTDPGDDLQASHPLREAKVVVEDIDDNPGFFRVKLFAVP
HFQVEGMDINLSLVSQMPKAKS
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3603094-3601556 Pseudomonas putida W619 chromosome, complete genome
ATGTCCGAAGATCAATCTTCTGCGCAATCGCGTGGCGCCACCGTGCAGGTGGAAGAAAACCAGAGCGTCT
ATCACGCGCTGTTTGAAAGAATAAACCTTGAGCCGCTTGAACAGATGGGTGGCATTGAGGTGTTCCAAAG
TATCGATGCGTTGTCAGAAGCGACAGCTAATGAGCGCGTTACTGCTTCGGTGAGCGTTTTTCTGGACCGT
CTCAAACAAGTCTCTCCGAAGGTGGAAAGGCTCGACAGGGCTCTACTGGATGAGCACATCGCCTCGATTG
ACGCTCAGATCAGCAGCCAGCTGGACGCGGTCATGCATCACCCGGATTTTCAACGGGTCGAATCAATCTG
GCGCGGCGCGAAGTCGTTGATTGACCAAACGGATTTCCGTCAAAACGTCCGAATTGAGCTGCTCGATATC
AGTAAGGAGCATCTGGCGCAGGACTTTGAAGACGCGCCGGAGATCGCGCAAAGCGGTTTGTATCTGCATA
CCTATACCCAGGAATACGATACGCCTGGTGGTGAGCCTATCGCGGCGGCAGTTTCGAATTATGAGTTTGG
GCGAGGGGCGCAAGATATCGCATTGTTGCGCAATGTTTCGAAAGTGGCGGCTGCATCCCATATGCCGTTT
TTGTACTCGGTTGGTCCGGCCTTCTTCGGAAAAAACACCATGGAGGAAGTGTCCGCGATCAAGGATATCG
GTAACTACATGGATCGTGCGGAGTATATTAAGTGGCACGGCTTCAGGCAAACTGACGATGCTCGTTATGC
GGGCGGGATAACACCCCGCACATTAGGGCGCTTGCCTTATGGGCCTGATACGAACCCTGTGCGATCTTTC
AACTATGTGGAGCGAGTCAAGGGGCCGGATCACAGCAAGTATTTATGGGTAAGCTCGACATTCGCGTTCG
CGGCGAACATGGTTAAGAGCTTTATTGCCAATGGATGGTGCGTGCAGATTCGAGGGCCACAGTCGGGTGG
CGCGGTTACCGACCTGCCGATTCATTTGTACGACATGGGGACGGGTAGTCAAGTCAAGATCCCCTCGGAA
GTTATGATTCCGGAGACCCGAGAGTTTGAATTTGCCAATTTGGGCTTGATTCCGCTCTCGTATTACAAGA
ATCGTGACTACGCATGTTTCTTCTCGGCCAACTCAGCGCACAAGCCGGCAATCTATGACACGGCGGAGGC
CACGGCAAATAGTCGTATCAATTCGAGGTTGCCCTATGTGTTCCTGCTTTCTCGCATTGCACATTATTTG
AAAGTTATCCAGCGGGAGAATATCGGTACAACTAAAGACCGTCGCCTGTTGGAGTTGGAGCTCAATAGAT
GGGTCAGTGGCCTGGTCACCGAGATGACCGATCCGGGAGATGACTTGCAAGCTTCCCACCCGCTGAGAGA
GGCAAAAGTGGTTGTCGAGGACATTGATGACAACCCGGGCTTCTTCAGGGTCAAGTTGTTCGCTGTGCCG
CATTTCCAGGTTGAAGGTATGGACATCAACCTCTCATTGGTTTCGCAGATGCCCAAAGCAAAATCTTGA