SecReT6
Protein ID: 170722430
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3261
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3603129..3603632 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1JAN8
KEGG IDppw:PputW619_3261
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-53, Aligned region: 7..159
Protein Sequence: 167 a.a.     [Download]
>gi|170722430|ref|YP_001750118.1| type VI secretion protein [Pseudomonas putida W619]
MASNSFQNEVPKARVNIKLDLHTGGAQRKVELPLKLILMGDYSNGKEKRQLSERPKVNINKNNFDSVLSD
LSPSLKVIVDDTLSGEGGETPVELSFQRMKDFEPEQVALQIPQLRALLAMRNLLRELKANLLDNATFRAE
LERILKDEALSDELRKELAALAPPSER
 
Nucleotide Sequence: 504 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3603632-3603129 Pseudomonas putida W619 chromosome, complete genome
ATGGCTTCAAATAGCTTTCAGAATGAAGTGCCGAAGGCACGTGTCAATATCAAGCTTGATCTGCATACAG
GTGGCGCCCAGCGCAAGGTGGAACTTCCCCTTAAACTCATTCTGATGGGAGACTACAGCAACGGGAAGGA
AAAGCGCCAACTGTCAGAGCGGCCGAAGGTAAATATCAACAAGAATAATTTTGACAGCGTGCTGTCCGAT
CTCTCTCCGAGTCTCAAGGTCATTGTTGACGATACGCTGTCGGGCGAGGGTGGGGAAACACCGGTCGAAC
TGAGCTTTCAGCGCATGAAGGACTTCGAGCCAGAACAGGTTGCTCTGCAGATTCCTCAGTTGCGTGCACT
ATTGGCGATGCGAAATTTGCTGCGCGAATTGAAGGCCAATCTTCTGGATAACGCAACGTTCCGTGCTGAA
TTGGAGCGGATACTTAAAGATGAAGCACTGAGTGACGAGTTGCGTAAGGAACTTGCTGCCCTTGCACCGC
CAAGCGAGCGCTAG