SecReT6
Protein ID: 170731787
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0434
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]466432..469623 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1JUM6
KEGG IDbcm:Bcenmc03_0434
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-71, Aligned region: 42..353
Phage_GPD [PF05954], Evalue: 2.30E-71, Aligned region: 603..650
DUF2345 [PF10106], Evalue: 3.50E-60, Aligned region: 668..820
DUF2345 [PF10106], Evalue: 3.50E-60, Aligned region: 939..1009
T6SS_Vgr [PF13296], Evalue: 3.40E-37, Aligned region: 524..630
Phage_base_V [PF04717], Evalue: 5.80E-21, Aligned region: 424..514
Phage_base_V [PF04717], Evalue: 5.80E-21, Aligned region: 875..894
Sarcoglycan_1 [PF04790], Evalue: 0.0058, Aligned region: 714..785
Protein Sequence: 1063 a.a.     [Download]
>gi|170731787|ref|YP_001763734.1| ImpA family type VI secretion-associated protein [Burkholderia cenocepacia MC0-3]
MNMQNTIAALRGGLLQQDRLLKLDTPLGSNVLTVQRAVGRSRIGRAYEFTLDVLSADSDLELKKLIAQPV
TLWIQQGDRSYRPVNGYVHTACRLGADGGLTTYQLAFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHP
QAKGHFRFALSKPLPNRSYTRQHDTDWHFVHRLMEDEGLYCAWQQADDGKSHTLVVTDNLQAFAPLSPQT
VRFYRGGAASEADAFTQWSGTRTLQSVTRSTRTFDYKNPAQPSNPKGTSLPTMAGQGELPDQLEVYEYTG
AYTYLDQTRGDHLTKIRMEQWESEAKRFHGAGGVRAIDAGRRFTLADHPEHDRDPADQREFAAIGVEWWI
ENNLPVANGSADFPYSLRDALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVSVPYRSPFEHRKPEM
HLETAIVVGPQGEEVYTDELNRIRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDY
VGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGGGYNQLVMDDATGQNRVQLMSSSANSLLHLG
YIIDQNGNARGSYLGSGFDLRSDAYGAVRASQGLYVTTHPKAANSQPLDVKEAQQQLVAGESLVEAMSGV
SEQHQAESLKDAQDTMRAFTDATQDSQSGSAAGGRTAGGGTGNANAFKEPVMLFGSPSGIGMSTQQSVHM
VANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVRVVSA
TDRIEIAADQGILLTSGGGYIRIKDGNIEIHTPGAVDVKGASHTFAGPASMGYPLPSPRPDQPGQLELFH
KYVNGEAVKGGLFTVKDVNGAVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRESDQPANYFKQVKWPAE
PVQPSPEAAQAAASGQLASQLQGMAPAATTAAMGLVSGGGAGAALGGLASAALPAAATALGGAGVASALQ
TASSLSGAAKQVAGMVQAARQGGLAALAAPAANAASGALQGALPGALPGVAGIAGKGATTVASAAGATGM
KLPTSGFGGPLKS
 
Nucleotide Sequence: 3192 bp     [Download]
>gi|170731356|ref|NC_010508.1|:466432-469623 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGAACATGCAGAACACAATCGCCGCATTGCGCGGCGGGTTGCTTCAGCAGGACCGGTTGTTGAAGCTCG
ATACGCCATTGGGGAGCAACGTCCTGACCGTGCAGCGGGCAGTTGGCCGTTCGCGGATCGGGCGCGCATA
CGAGTTCACGCTCGACGTGTTGTCGGCCGATAGCGATCTGGAGCTTAAAAAGCTGATCGCGCAGCCGGTC
ACGTTGTGGATTCAGCAAGGCGATCGCAGCTATCGGCCGGTGAATGGCTACGTGCACACCGCGTGTCGTC
TGGGCGCTGACGGCGGGCTCACGACCTATCAGCTCGCGTTCGCCGATTTCACCCATTTCCTGAAGTTCCG
TCGCGACCAGCGGATCTGGAACGATACGACCGTCGACCAGATCATCAGCGACGTGCTGAACCAGCATCCG
CAGGCGAAAGGCCATTTCCGCTTTGCGCTGTCGAAGCCGTTGCCGAACCGCTCGTACACGCGACAGCACG
ACACCGACTGGCATTTCGTGCATCGGCTGATGGAGGACGAAGGGCTCTACTGCGCGTGGCAGCAGGCCGA
CGACGGCAAGTCGCACACGCTCGTGGTGACCGACAACCTGCAGGCGTTCGCGCCGCTGTCGCCGCAGACC
GTGCGCTTCTATCGTGGCGGGGCGGCGAGCGAAGCCGATGCGTTCACGCAATGGTCGGGCACGCGCACGC
TGCAAAGCGTCACGCGATCGACGCGCACGTTCGACTACAAGAATCCCGCGCAGCCGTCGAATCCGAAAGG
CACGTCGTTGCCGACGATGGCCGGTCAGGGCGAATTGCCCGATCAACTCGAAGTCTACGAATACACCGGT
GCGTACACGTATCTGGACCAGACGCGCGGCGATCATCTGACGAAGATCCGGATGGAGCAGTGGGAGTCGG
AGGCGAAGCGTTTCCACGGCGCGGGTGGCGTGCGTGCGATCGATGCCGGCCGGCGCTTCACGCTGGCGGA
TCATCCCGAACACGATCGCGATCCGGCCGACCAGCGCGAATTCGCGGCGATCGGCGTCGAATGGTGGATC
GAGAACAACCTGCCCGTTGCGAACGGCAGCGCGGATTTTCCGTACAGTCTGCGCGACGCGTTGACGCAAG
CGCAGGAGGGCTACGGTGCCGACCCCGCGTTTCGCGTGCCGCACGACGACGGCTCGGTCGGCTTCTATCT
CGTCGAGGTCGAAGCGCAGCGCGTGAGCGTGCCGTACCGCAGCCCGTTCGAGCATCGCAAGCCGGAGATG
CACCTCGAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGGAGGTTTATACCGACGAGCTGAACCGGATTC
GCGTGCAGTTCGTGTGGGATCGCCTGAACCCGGGTAACGAGAACGCGTCATGCTGGGTGCGCGTCGTGCA
GTCGGATACGGGCGGCGGCTACGGCGGCGTGCACGTGCCGCGCATCGGCGAGGAAGTGTTGATCGACTAC
GTCGGCGGCGACTGCGACCGGCCGCTGGCCGTCGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGC
ATAGCGACGGGATTCTGTCCGGCTATCGGTCGAAGGAGTATTCGGGCGGCGGCTACAACCAGCTCGTGAT
GGACGACGCGACCGGGCAGAACCGCGTGCAACTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGC
TACATCATCGACCAGAACGGCAATGCGCGCGGATCGTATCTGGGCAGCGGTTTCGATCTGCGCTCGGATG
CATATGGCGCGGTGCGGGCGAGCCAGGGCCTGTACGTGACGACCCACCCGAAGGCGGCGAACAGCCAGCC
GCTCGACGTGAAGGAGGCGCAGCAGCAGCTCGTGGCGGGCGAGAGCCTGGTCGAGGCGATGTCGGGCGTG
AGCGAGCAGCATCAGGCGGAGAGCCTGAAGGACGCGCAAGACACGATGCGCGCGTTCACGGACGCGACGC
AGGACAGCCAGTCGGGCAGCGCGGCGGGCGGGCGCACGGCGGGCGGCGGTACCGGTAACGCGAACGCGTT
CAAGGAACCGGTGATGCTGTTCGGCAGCCCGTCGGGAATCGGGATGTCGACGCAGCAGTCGGTGCATATG
GTCGCGAACGATCACGTGAACGTGGCGAGCGGACAGAGCGTGCACGTGGCCGCGGGCAAGTCGCTGATCG
GCAGCATCGGGCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAA
GGTCGAGATCCAGGCGCAGTCGGACAACGTCGAGGTGACCGCGCAGAAGGCGGTGAGGGTGGTGTCGGCG
ACGGACCGGATTGAGATCGCGGCTGATCAGGGGATTCTGCTGACGAGCGGCGGCGGATATATCCGCATCA
AGGACGGCAACATCGAGATTCATACGCCGGGCGCGGTCGATGTGAAAGGGGCGTCGCATACGTTCGCGGG
GCCGGCGAGCATGGGGTATCCGCTGCCGAGCCCGCGGCCGGATCAACCGGGGCAGCTCGAGCTGTTTCAC
AAGTACGTGAACGGCGAGGCGGTGAAGGGCGGGCTGTTCACGGTGAAGGACGTGAACGGCGCCGTGCTGA
AGAAAGGCGCACTCGACAACAGCGGCTATACGGTCGTGAGCGGCTTGCCGCCCGGGGCGGTGCGCGTCGA
ATTCGGGAAAGACCCACGCGAGTCGGATCAGCCGGCGAACTATTTCAAGCAGGTGAAGTGGCCGGCGGAG
CCCGTGCAACCGTCGCCCGAGGCCGCGCAGGCCGCGGCGAGCGGACAGCTCGCGAGTCAGCTGCAAGGGA
TGGCGCCGGCCGCGACGACCGCGGCGATGGGGCTGGTGAGCGGCGGCGGCGCGGGTGCGGCCCTCGGCGG
GCTCGCGAGCGCCGCATTGCCGGCTGCTGCGACCGCGTTGGGTGGCGCCGGCGTGGCGTCCGCGTTGCAG
ACCGCGTCGAGCCTGAGCGGTGCGGCGAAGCAGGTGGCCGGGATGGTTCAGGCCGCCCGTCAGGGCGGGC
TTGCCGCGCTGGCCGCGCCGGCTGCGAATGCGGCGTCCGGGGCGTTGCAGGGCGCGTTGCCCGGTGCATT
GCCGGGCGTGGCCGGTATCGCGGGCAAGGGCGCCACGACCGTGGCCTCGGCCGCGGGCGCGACGGGCATG
AAGCTGCCGACAAGCGGGTTTGGCGGACCGTTGAAATCCTGA