SecReT6
Protein ID: 170731794
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0441
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]479068..479850 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1JUN3
KEGG IDbcm:Bcenmc03_0441
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|170731794|ref|YP_001763741.1| hypothetical protein Bcenmc03_0441 [Burkholderia cenocepacia MC0-3]
MSYAPSLFGDNVPPPSHSPASTDAAFQARSLLDLLYDGFFMLFLLKNKREPDSASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVW
AIGTVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c479850-479068 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGTGCCGCCGCCCTCGCATAGTCCGGCGTCGACGGACG
CCGCGTTCCAGGCCCGCTCGCTGCTCGATCTGCTGTACGATGGGTTCTTCATGCTGTTTCTGCTCAAGAA
CAAGCGGGAGCCGGACAGCGCCAGCGAGTTCAGCACGCGGATCCAGGAGTTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCCGAGGACGTGTACGGTGCGAAGTTCGCGTTCTGCGCGGCCATCG
ACGAAATGGTGCTGTCGTCGCAGTTCAAGATCCGCGCGGATTGGGAACGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAGTGTCGTGCGCAGGGTGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTCGCGTATCTGACCGCGCGGCTTGGGGACGAGATCGCGCATATGAAGGGCAAGCGGGC
TGCGTTTGCGCCGCATTGGCCGCTGCCGGACCAGATCGCGCACCGGTTGAAGCGCGAGGTGCCGGTTTGG
GCGATCGGGACCGTGTTCGCGCTCGTTGCGTTGCTTGGGTATCTCGGGCTCAATACCTATCTCAAGGACA
AGACGCTGCAGGCGTTGGCGCCGTATTCGCAGGTGATCAAGGTGGGGCCGGAGTCGGCTAATTTGACGAT
TTCGTTGCCTTGA