SecReT6
Protein ID: 170731795
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0442
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]479847..481193 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1JUN4
KEGG IDbcm:Bcenmc03_0442
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|170731795|ref|YP_001763742.1| type VI secretion protein [Burkholderia cenocepacia MC0-3]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c481193-479847 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAACGGCAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGGGTCGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCTGACGATCTGCCGCCGCCGATCGCGCTGGATACGTTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGTTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGGTTCGTCAGCGAGCAGACGAGCGTCGCCGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTTTCGGTGCCGCTCGTGCGTGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCA
CTGCAGGCCAAGGTGAACGCGCTGTACGGCTTTCACCGCGAACCGTCGAAGAACATCATCGAATTCCGCT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCATACGGCGAATGCCGCATTCGCGACGCTCGCGCACCTGCA
CCAGCACGCGGCACTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGACCTGCCCGTGTACCGCCACGACGACCCGGGCCCGAGCTTCGCGC
GCCTCGACCTGATGCTGCGCGAACTGCTCGACACCGTGATTTCGACGCGCTATTTCGCGATCACGCTCGA
CGAGGTGCGCCCGTCGTTCCACCTCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTCGCGGTGTCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCCGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCCGGCGCGTGCTACTTCGCGCTCGATTCACGCAGCCCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTATGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA