SecReT6
Protein ID: 170731796
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0443
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]481296..481907 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB1JUN5
KEGG IDbcm:Bcenmc03_0443
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 15..175
Protein Sequence: 203 a.a.     [Download]
>gi|170731796|ref|YP_001763743.1| hypothetical protein Bcenmc03_0443 [Burkholderia cenocepacia MC0-3]
MRSSMIRYALPLVACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQKPPRNIGLTLAAAPNLNAATD
HKPLALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c481907-481296 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGAGATCGTCCATGATTCGCTACGCGCTGCCGCTGGTTGCCTGCGCCCTTCTGGCCGGATGCGCGGCCG
CCCCGCTGCTCGGCTCGGCCGCGAGCGCCGTGATGTCCGCGGCCGGTATCGGCAAGCCCGAGGTACCCGA
CGCTCAGAAGCCGCCGCGCAACATCGGGCTCACGCTGGCCGCCGCGCCGAACCTGAATGCCGCGACCGAC
CACAAGCCGCTCGCGCTCGTCGTCCGGCTTTATGCGCTGAAGGACCCGACCTCGTTCCAGCAAGCGCCGT
TCGACGCATTTACCGATCCGACCAAGGAAAAAGCCGCACTCGGCGCCGATCTGTTGAATGTGCGCGAAAT
CACGCTGATTCCGGGCCAGCGCTATACGGCGACCGAGAAGGTATCGCGCGAAGCCCAGGCATTCGGCATC
GTCGCGCTGTTCCGCGATCCCGCGCTGCAACGATGGAAACTGACATTCGATCCGGCGAAATCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGACGGCACGGTCATCGCACCGCAACA
AGGTGCGCCTTCGCAACCGCTGAATTTGCTGTCTTCGGTCTCTTGCGGTTAA