SecReT6
Protein ID: 170731798
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0445
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]482962..483477 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB1JUN7
KEGG IDbcm:Bcenmc03_0445
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|170731798|ref|YP_001763745.1| type VI secretion protein [Burkholderia cenocepacia MC0-3]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|170731356|ref|NC_010508.1|:482962-483477 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACGTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGTCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGTAAATTCGTCAACATCGACCGCGATAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGTGCCGCGTTCCAGGTGGAAAACCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA