SecReT6
Protein ID: 170731799
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0446
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]483493..484983 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1JUN8
KEGG IDbcm:Bcenmc03_0446
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.20E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|170731799|ref|YP_001763746.1| EvpB family type VI secretion protein [Burkholderia cenocepacia MC0-3]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|170731356|ref|NC_010508.1|:483493-484983 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCGGGGACTTCGCTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCCACGATCGACGCACGC
GTCGCGGAGCTCGACCGCCTGATTTCCACGCAGCTTTCCGCCGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGATGGATTATCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGTGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCATGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACCGTCGAATACGCGAAGTGGAAGTCGTTCCGCGACGCCGAGG
ATTCGCGCTACGTCGGCCTGACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGGCATGGGCCTTCGCGGCCCGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGATCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCAGATTACGCCGCGTTCTTCGCTGCGCAGTCGGTGCAGAAGCCCAAGA
AATACAGCACCGACAGCGCGAACGCGAACGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGTAGCTTCGCGTCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCCTCGCAGGAACAGAAAG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTGTCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA