SecReT6
Protein ID: 170731800
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0447
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]485054..485557 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDB1JUN9
KEGG IDbcm:Bcenmc03_0447
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|170731800|ref|YP_001763747.1| Hcp1 family type VI secretion system effector [Burkholderia cenocepacia MC0-3]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|170731356|ref|NC_010508.1|:485054-485557 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAATCCGCGGATAAAGACCACCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCTTCGGGCGGTACCACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCCGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA