SecReT6
Protein ID: 170731802
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0449
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]486182..488017 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB1JUP1
KEGG IDbcm:Bcenmc03_0449
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|170731802|ref|YP_001763749.1| type VI secretion protein [Burkholderia cenocepacia MC0-3]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAQAGFAEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRC
QRATLHLVLQDVRSDSHIARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|170731356|ref|NC_010508.1|:486182-488017 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAACGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGGCTCGCGCTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCATTCGCGCTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGATTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCGTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCGATCGCGGCACCGAGCTGAAAAGCCG
TCCGATCCGCGGCGTGCAATGCCGGTTCCGTACCGCCTACGACGTGACGCTTGCGCCGATCCGCATCTCG
GAAGCGCGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCGAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGTCGACGCTGCGCGC
GCACCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGATTGCCTGTTCGTCAACGTGCTCGGTGCG
TACGTCGAGCCCGAACGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCAGGCCGGCTTCG
CCGAGGACGACGCGCTGATCGACTATCCGGCGAAATCGCACCCCGCGTACCGGCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGACTTCGACCTCGCGGCGATCGCACGCGCATCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCATATCGCGCGCTTGCTCGAAC
TGCTGACGGCGAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTTCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATCGCCGAGGCGCGGCGTGCGTTCGCGTACGAG
GTGTACTCGATCGACTCGGTGAAGCTCGTCCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCACTGCATCACGGCGAATCGGCGCGCATCGGCCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAGAGCCCCGGCTATGAAACCGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGACCTGCCTTCGATGCTGGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGGGCGCAGACGAGCGGCATCTCGCTGCTGCGCCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTCAAC
CACGTGTCGCTCGTCGCGCACGGCCTCGCGCCGCTGAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CGGCCGTGTCGATGCGCCAGATCGACGGTCTGGCCGGCGTCGAGCAGCGCGGGGCGGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAGGAGCACTTCGTC
GGCGCGAGCCTTGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCACCTCAACAGTT
TCGTTCAATTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG